SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000001808 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000001808
Domain Number 1 Region: 143-449
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-98
Family Protein kinases, catalytic subunit 0.0000000000981
Further Details:      
 
Domain Number 2 Region: 12-123
Classification Level Classification E-value
Superfamily PH domain-like 2.44e-16
Family Pleckstrin-homology domain (PH domain) 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000001808   Gene: ENSTRUG00000000753   Transcript: ENSTRUT00000001816
Sequence length 478
Comment pep:known_by_projection scaffold:FUGU4:scaffold_201:31744:43333:-1 gene:ENSTRUG00000000753 transcript:ENSTRUT00000001816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYASSHLKSSSLGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQLMK
TERPKPNTFIIRCLQWTTVIERTFHVDSPDERDEWTEAIQMVADKLQRQEEERIQCSPTS
NIDNMVEEEMDISTTHHKRKVTTMSDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKK
EVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRER
VFSEERTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHMKITDFGLCKEGITDAA
TMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILME
DIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGIDWQDVYDKKLVPP
FKPQVTSETDTRYFDEEFTAQTITITPPEKFDEDGMDCLDNERRPHFPQFSYSASGRE
Download sequence
Identical sequences H2RNU5
31033.ENSTRUP00000001808 ENSTRUP00000001808 ENSTRUP00000001808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]