SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000002658 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000002658
Domain Number 1 Region: 382-770
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.96e-125
Family Oxysterol-binding protein 0.0000465
Further Details:      
 
Domain Number 2 Region: 131-251
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-23
Family Pleckstrin-homology domain (PH domain) 0.000000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000002658   Gene: ENSTRUG00000001140   Transcript: ENSTRUT00000002672
Sequence length 890
Comment pep:known_by_projection scaffold:FUGU4:scaffold_167:62370:77422:-1 gene:ENSTRUG00000001140 transcript:ENSTRUT00000002672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEEGLLSRRRFSTCGGTASLRPPHPDGRKLIRNASFGGYNELSPLSLPGFSFKTFHHNH
PSIHPSSAPLSISGGSGVVPGSETKLYNGSDKDVSASGGKLTKKESLKVQKKNYREEKKR
ATKELLSTITDPSVIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYKTHKNGQWVGTVLLN
ACELIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPSSHLIFRAASESDGR
CWMDALELALKCSSLLKRTMIREGKEDASKLDPNPSSSSLHCGHQVPFHHLICPSCRFND
TDHLKDPDLYSDKSDREGEQDHEESDPEGLEKSEESDSDTSERQDDSYIDMDPNEHLRET
PYMEQSHEELGEAGEAAQTETVSEENKSLIWTLLKQVRPGMDLSKVVLPTFILEPRSFLD
KLSDYYYHADFLSEAAIEENAFNRMKKVVKWYISGFYKKPKGLKKPYNPIIGETFRCMWL
HQKTNSKTFYIGEQVSHHPPVSAFYVSNRKDGFCLSGSILAKSKFYGNSLSAILDGEARL
TFLNRGEDYVMNMPYAHCKGILYGTMTLELGGQITIACEKTGYSAQLEFRLKPFLGSSDS
VNLISGKIKLGKEVLATLEGHWDSEIFINDKKTGTVDTFWNPTPELRQSRLTRCTVPPEE
QGEFESERLWQHVTRAINNKDQTEATNEKFVLEEVQRKSARERKAKCEEWIPALFEQDPI
TGEWHYRYADTRPWDPLNDLIQFEKDGCIQTKVRHRTPMVTVPKRKHKSDKPKSPESGCS
SPEPDHQDSSGSERELSCYTLNIFNPKLHTFVAGHKSKHNNRLRKKGTDLSELQSAIESI
KKTQEDINRIVSVLRGRTVSRAEGGFLQQRDFVLIVFLVLLQVLINYVFK
Download sequence
Identical sequences H2RR92
ENSTRUP00000002658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]