SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000003240 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000003240
Domain Number 1 Region: 67-182
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.39e-27
Family Glutathione peroxidase-like 0.0005
Further Details:      
 
Domain Number 2 Region: 198-324
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000141
Family PDI-like 0.02
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000003240
Domain Number - Region: 8-41
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0138
Family Glutathione peroxidase-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000003240   Gene: ENSTRUG00000001410   Transcript: ENSTRUT00000003259
Sequence length 326
Comment pep:known_by_projection scaffold:FUGU4:scaffold_271:116072:124133:1 gene:ENSTRUG00000001410 transcript:ENSTRUT00000003259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHISAHRDPLGMKLWNKYKVTSIPSLVFVDTVTGKVVCRNGLLVVRDDPKGLEFPWGPKP
FAEVVAGPLLRNNRQTTDSSSLEGHYVGVYFSAHWCPPCRSLTRVLVETYRAVKESGQKF
EIVFVSADRSEESFKQYFSEMPWLAVPYSDEARRSRLNRLYGIQGIPTLILLDAEGHMIT
RQGRVEVLNDPECRLFPWHPRPVLELSESNAVQLHEGPCLVLFVDAEEEGELEPAKELIQ
PIAEKLMAKYKAKEEEMPLLFFVAGEDDMTESLRDYTNLPEAAPLLTILDMSARAKYVSD
VEEITPAVVDQFVSDFLADKLKPEPI
Download sequence
Identical sequences H2RSX3
ENSTRUP00000003240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]