SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000003321 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000003321
Domain Number 1 Region: 828-1008
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 2 Region: 157-186,268-380
Classification Level Classification E-value
Superfamily PH domain-like 8.15e-27
Family Phosphotyrosine-binding domain (PTB) 0.008
Further Details:      
 
Domain Number 3 Region: 984-1102
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.11e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0095
Further Details:      
 
Domain Number 4 Region: 1-133
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000461
Family Phosphotyrosine-binding domain (PTB) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000003321   Gene: ENSTRUG00000001440   Transcript: ENSTRUT00000003340
Sequence length 1200
Comment pep:known_by_projection scaffold:FUGU4:scaffold_333:22707:41192:-1 gene:ENSTRUG00000001440 transcript:ENSTRUT00000003340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYKLTLIGSLSVHYLTTMAMLPWVVAEISKAQDSEKKPAEHGPSPQIVFLCVSVSWVRCV
SILGEELLWDPLTHRLLFECLPHQVTKLIHNSQEPSSFGCLVRDSANCACYVFRCQDSSK
VPEIISVLRKAGKSSARNDNTGGSSLSTIPTTVDSDLLFSTNFAKRFEVLFCGRVTVPHK
NAPPALIDECIVKFSQLQNSVVSLREGDTLGLRDGLKTLVVPANGLKSIDVHDGSTGSPT
TGKHPVLFKRAPSFPCLQALDENGLSPEICQAITTESHLHLTGVQPTSQQQNSNMLFMVT
GSQILLVSPETKKTSMEKSFREISFCSQGIHHVDHFGFICRETAEEGNCHFVCYVFQCAS
ESLVDEIMLTLKQAFSRAVEWKKSNPQWQQCDACPLMQFHRLCERIEGLSPFDTKLELQK
HSASLDNQEQASVFEVAMRSCPKSDKEENELVMASLRRLYEKKQSNHQHSVTQNSEEICE
KAAPTNLEAHHSSSQQKLGQLKSRAKRSLTESLEGIWKGGNRARTQTNLRTHIERHSSKE
YEMPQWSSGDLKHLDPPSALATYTFSKQGDAELQGVRRRANTFSHSPTPQSAEHSLEYTL
KTQKVAASDTSKLSRHYSLSSDTPHQSNFSLFSFSPYSHFKFPLFLRHAPADSTLPPVPP
SPPSAPPFSPSSGARLMKRSAAAALSHPSSTFEMDESPLRSHSHSWRQQIFLRVATPQKS
TENIGKKRKCYLDCCFVLPLNNTLVQYSEERLCIYHEVGNVQEKKLNRSKDELRELWRTA
IKQQILLQRMEKENLKLKAASENNLQNKRLKLDYDEITPCLKEVTLVWEKMLATPDRPKV
KVDMEIIHAALAQGVPKQHRGEVWKFLSEQHLLRQTVSSQPPPDNTAYKELLKQVSSEQH
AILIDLGRTFPTHPYFEESMGPGQLSLYNVLSAYSVLDPEVGYCQGLCFVTGVLLLHLEE
EDAFNMLKFLMFVLGLRQQYKPSMTAVQIQMYQLSRLLHDYHKDLQCHLEQQDIAPSLYA
PPWFLTNFASQYPLGFVARVFDMLFLQGPEVIFKVGLSLLGSHKLLIMQHDSLESIVDVI
KTELPNLGLVQMEKTVNQVCEMDLTKQLQAYEVEYQVLNDELHAPSDQRSAHLEKVYQSL
QQQNSELMEELQVSHVRVSSLEQQLESLVQSERLLKEQVSTLELEKNQLVDTVARLQQIL
Download sequence
Identical sequences H2RT54
ENSTRUP00000003321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]