SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000004368 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000004368
Domain Number 1 Region: 80-161
Classification Level Classification E-value
Superfamily Virus ectodomain 2.67e-19
Family Virus ectodomain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000004368   Gene: ENSTRUG00000001900   Transcript: ENSTRUT00000004392
Sequence length 272
Comment pep:novel scaffold:FUGU4:scaffold_4623:238:1124:-1 gene:ENSTRUG00000001900 transcript:ENSTRUT00000004392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WWLCGHNAYAHLPANWSGVCAPVHLKDHTIIIYANNTENIAQKRFKRDLNEYEFKPHDSV
WGTDVPQEFKHWTDGQKVSISLFPWVGVAKNILRLETVDYRLKVFTNLTKVALAGVKEEM
TALRLMTMQNRMALDLITAPQGGVCAMVGDYCCTFIPENDADGHLIDSALRNLTKLQRAM
IDDGSPPPDWLTKMLSGWRELLFKIGIMIGIVLLVLAILACCVVPLVRGCIGRLVGSVVT
STLLQVEEQSLLDDDEEESEEEWINVIQDEND
Download sequence
Identical sequences H2RW48
ENSTRUP00000004368 31033.ENSTRUP00000004368 ENSTRUP00000004368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]