SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000004380 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000004380
Domain Number 1 Region: 401-567
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-50
Family SPRY domain 0.00025
Further Details:      
 
Domain Number 2 Region: 137-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000145
Family B-box zinc-binding domain 0.00073
Further Details:      
 
Domain Number 3 Region: 9-68
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000117
Family RING finger domain, C3HC4 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000004380   Gene: ENSTRUG00000001904   Transcript: ENSTRUT00000004404
Sequence length 572
Comment pep:novel scaffold:FUGU4:scaffold_244:16107:18355:-1 gene:ENSTRUG00000001904 transcript:ENSTRUT00000004404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSFPSPPELYCPLCADALRDPVTIPCGDTYCLECIKIYWDQFDHMGVYSCPQCRATF
TPRPVLRRNLPDVNHEPRRQLPELMPFPYMHRESYCDFCVGRRNKAVKSCLMCLAYYCET
HVKPHYESSTFKRHKLVDETGHLDRKICPQHEKGLELFCRSDQMCICVLCTVREHRGHNI
ASAEEERIEKQKILVVTQSEVQYIIQERMKELQELKHNVDVLKNGAQRAQAESDKTFHEM
LQAVERWKAEINQMIMANMQAAMGQADGYVERLEQEIMELQRRDAELRQILETEDNIHFL
QNFPTLCVPPEAMVPKVLINPQFSFAEMSKTAIDMKEHLDDICKKELSKISKTVNETPVY
ILLPRNGDKRLKDYNDRVSSVPSRADLQEPKTRADFLRYSCKMTFDPNTAYKELVMSDGN
QKVMRKKTVHFYPDHPERFDGFSQVLCKEPLSGFRFYWEAEWTGEFSIGVAYRSISRKGK
NSHSLLGYNDKSWSLLCSDSGYSAWHSKVDRDLPDAPRATRIGVYLDYAGNTVAFYTVKE
NMELIHKFKAQFSEPLYAGFGVGSSVTLCQLR
Download sequence
Identical sequences H2RW60
ENSTRUP00000004380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]