SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000005000 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000005000
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 1.91e-22
Family Caspase recruitment domain, CARD 0.00031
Further Details:      
 
Domain Number 2 Region: 109-192
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000785
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000005000   Gene: ENSTRUG00000002177   Transcript: ENSTRUT00000005030
Sequence length 199
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2863:3700:4989:-1 gene:ENSTRUG00000002177 transcript:ENSTRUT00000005030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEHRALLREHRLQLSAQLLVSDTIIPFLYQENVLTRTQVEEIESLATSRQKTLKLLDI
LPNCGPRAFHAFLQSLEDFRWIRDQLLLDLQERAGQESRGEDSWNFPHSRLQRVPSDQEL
SRLASRLGAEWESVLLDLGLSVETLFRCRADHSLSAHGAVLAGLVQWRRCGGKGATFQRL
IQSLKKADVHPSVLGEVLT
Download sequence
Identical sequences H2RXY0
ENSTRUP00000005000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]