SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000006437 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000006437
Domain Number 1 Region: 209-345
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.24e-34
Family Eukaryotic proteases 0.001
Further Details:      
 
Domain Number 2 Region: 118-219
Classification Level Classification E-value
Superfamily SRCR-like 8.37e-16
Family Hepsin, N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 84-121
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000006437   Gene: ENSTRUG00000002768   Transcript: ENSTRUT00000006478
Sequence length 393
Comment pep:known_by_projection scaffold:FUGU4:scaffold_165:454146:456884:-1 gene:ENSTRUG00000002768 transcript:ENSTRUT00000006478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTNLYQDMPPFIHGDHKMKTLSRLDVRPQYVHHLAPKPPAEANQSAPKHKDWKQMCVKR
SVTSVISLLILLLLAGILLAYYFSSTCIHGLQCGDSSCVWASQWCDGVEDCPAGQDEANC
VRLHGSGFVLQVYGSGGWRNVCSRGWSAQHGRASCLEMGYSRGTFFQSGQQRVNSEGGFF
QLKSDFYPEASILQQFVLTNSCPDDSVVTLQCTDCGRGVNSSRPSAGTWPWQVSLQLAGS
HYCGGAIVSPYWLVTAAHCVLRDPRPAAWTVYAATVNPLDTLFTPAHFVSHIVIHEGYNS
LTHTGDIALMRLKKPLDFTDSNIGPVCLPNIGLNITDQQHSWITQLSGSGDAGQPSGDPE
EWSLVAHWGHNLGGQMHQHQLLSGLDTPTNEGK
Download sequence
Identical sequences H2S216
ENSTRUP00000006437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]