SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000006703 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000006703
Domain Number 1 Region: 390-555
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-48
Family SPRY domain 0.00033
Further Details:      
 
Domain Number 2 Region: 2-70
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000429
Family RING finger domain, C3HC4 0.0096
Further Details:      
 
Domain Number 3 Region: 135-193
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000111
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000006703   Gene: ENSTRUG00000002882   Transcript: ENSTRUT00000006748
Sequence length 559
Comment pep:known_by_projection scaffold:FUGU4:scaffold_534:26601:31077:-1 gene:ENSTRUG00000002882 transcript:ENSTRUT00000006748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLEEDLSCSICLSTFDCPVTVPCGHNFCNNCLLLTWADCCSFSCPQCRAVFPTRPDLKKN
TVLSTIVESFSSKMADKMEAKLSGEPTKVEKDGVILCDTCMETEASKTCLTCMASFCEEH
LKPHRMNPVFSLHPLVEPVRNLFEWTCQNHHKLMEFFCSQHGQVICSLCLQQDHKGCCVI
SAEEQRNLKKGPVRFDLDKKRVQNEKVINSATSTKKALAAEYQRIRDMLTQEEQNALLAV
DHEVQNGHVKIKTLMKKFTSNISTISKAKEHIQTAKFDPHTPRINLDSPNVKLSKDFATS
LNQFLTEASHVVHVPADATAATGSSMSSVCVVCMSEPTCSCWDAVKKDLSKSMENLLNMK
EMLSGLHVASASKLGAGKDSRLHFKYARTLTLDRTTANKRIVMSDGYTRATVADQPLNYP
NCPQRFTVCSQVLGSTGFNTGRHYWEVLLSSNNFIGIGLTYQDIDRGGLSSRLGRNSVSW
CIEWLNNKLSAWHDTKETVLENTHPKCVGVLLDCEGGTATFYNVAKKATPFHSFVFHFAK
AVYPAFWVFPGGSSLSLRR
Download sequence
Identical sequences H2S2T1
ENSTRUP00000006703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]