SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000006704 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000006704
Domain Number 1 Region: 371-537
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-47
Family SPRY domain 0.00082
Further Details:      
 
Domain Number 2 Region: 8-76
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000303
Family RING finger domain, C3HC4 0.0096
Further Details:      
 
Domain Number 3 Region: 141-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000087
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000006704   Gene: ENSTRUG00000002882   Transcript: ENSTRUT00000006749
Sequence length 537
Comment pep:known_by_projection scaffold:FUGU4:scaffold_534:26634:31095:-1 gene:ENSTRUG00000002882 transcript:ENSTRUT00000006749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMAGLLQLEEDLSCSICLSTFDCPVTVPCGHNFCNNCLLLTWADCCSFSCPQCRAVFPTR
PDLKKNTVLSTIVESFSSKMADKMEAKLSGEPTKVEKDGVILCDTCMETEASKTCLTCMA
SFCEEHLKPHRMNPVFSLHPLVEPVRNLFEWTCQNHHKLMEFFCSQHGQVICSLCLQQDH
KGCCVISAEEQRNLKKNSATSTKKALAAEYQRIRDMLTQEEQNALLAVDHEVQNGHVKIK
TLMKKFTSNISTISKAKEHIQSVLKEPQTLAFLQVPANPRQQQRRINKVRKDSTKAEASH
VVHVPADATAATGSSMSSVCVVCMSEPTCSCWDAVKKDLSKSMENLLNMKEMLSEGPQEA
LDITSVKDPHELLIYARTLTLDRTTANKRIVMSDGYTRATVADQPLNYPNCPQRFTVCSQ
VLGSTGFNTGRHYWEVLLSSNNFIGIGLTYQDIDRGGLSSRLGRNSVSWCIEWLNNKLSA
WHDTKETVLENTHPKCVGVLLDCEGGTATFYNVAKKATPFHSFVFHFAKAVYPAFWV
Download sequence
Identical sequences H2S2T2
ENSTRUP00000006704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]