SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000006728 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000006728
Domain Number 1 Region: 8-205
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-68
Family Nuclear receptor ligand-binding domain 0.00000000902
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000006728   Gene: ENSTRUG00000002888   Transcript: ENSTRUT00000006773
Sequence length 252
Comment pep:known_by_projection scaffold:FUGU4:scaffold_41:212:2206:1 gene:ENSTRUG00000002888 transcript:ENSTRUT00000006773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNSSEHRVSLDVSLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILI
LRICTRYTPDQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFSFASQLLPLEMDDAETGLLS
AICLLCGDRQDLQESDKVDILQEPIVEALKMYVRRRRPEKPCMFPKILMKITDLRSISVK
GAERVITLKMEIPGSMPPLIQEMLENSDGVEGHGAGGGKARKEEQMQQGSRRPSPSPKSI
PSPSISPALGSP
Download sequence
Identical sequences H2S2V6
31033.ENSTRUP00000006728 ENSTRUP00000006728 ENSTRUP00000006728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]