SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000007473 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000007473
Domain Number 1 Region: 266-494
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-64
Family Nuclear receptor ligand-binding domain 0.00000014
Further Details:      
 
Domain Number 2 Region: 28-113
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.81e-31
Family Nuclear receptor 0.0000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000007473   Gene: ENSTRUG00000003189   Transcript: ENSTRUT00000007520
Sequence length 506
Comment pep:known_by_projection scaffold:FUGU4:scaffold_250:97730:103470:-1 gene:ENSTRUG00000003189 transcript:ENSTRUT00000007520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQSPPTPHPLKAWELGKSRRKHSTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQ
NNAMYSCSRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQK
HQQSQECAVHGTREESVDLGDHGCAYRRGSGTALGDLDEITTLPDGLLFDLPLTPEDEGG
DYCNLEMLGGSAGSSSSSQSSPEQNNLDCVDKHGIKHEYQLLHDSGLFSHTIHNPLPEPC
SLLDTDVGTSLVTQVPFFPVCVERITQSVVKSHIETSQYSTEELKRMAWTLYSPEETHSY
QMKSAEAMWQQCAVHITNAIHYVVEFAKRITGFMDLCQNDQIILLKAGCMQVLLIRMCRA
YNPINNTLLFDGKCATPQLFKALGCDDLVNAVFDLAKGLSRLQMSEEEMALFSAAVLLSP
DRPWLTDVQKVQKLQEKVYVALQRCLQRDGASEMVSKLPVMKSICNLHIDKLEFFRLVHP
ETAYTFPPLYREVFGSEVTFPDSTEG
Download sequence
Identical sequences H2S501
ENSTRUP00000007473 31033.ENSTRUP00000007473 ENSTRUP00000007473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]