SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000007668 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000007668
Domain Number 1 Region: 22-133
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.43e-36
Family PDI-like 0.0000255
Further Details:      
 
Domain Number 2 Region: 365-470
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.09e-32
Family PDI-like 0.00065
Further Details:      
 
Domain Number 3 Region: 230-363
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.48e-27
Family PDI-like 0.033
Further Details:      
 
Domain Number 4 Region: 142-242
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.97e-25
Family PDI-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000007668   Gene: ENSTRUG00000003279   Transcript: ENSTRUT00000007715
Sequence length 506
Comment pep:known_by_projection scaffold:FUGU4:scaffold_244:31623:38707:1 gene:ENSTRUG00000003279 transcript:ENSTRUT00000007715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKFLLLCTLVVASRAEIAEEDDVLVLKKSNFDEALKAHPNILVEFYAPWCGHCNALAPQ
YAKAAATLKEEGSEVRLAKVDATEETDLAQEFGVRGYPTIKFFKGGDKDSPKEYSAGRQA
EDIVSWLKKRTGPAVASLTGVTEAESLIADNEVAVIGFFKDGSSADAKAFEKAAEAIDEI
PFAMTSDDAVFSKFEVSTDSVVLFKKFDEGRNTFDGEVTKENLLNFVKSNQLPLVIEFTE
QTAPKIFGGEIKSHILMFLPKAASDFQDKMDQFKKAAEGFKGQILFIFIDSDIEDNQRIL
EFFGLKKEECPAIRLITLEDEMTKYKPESDAITTEGIIEFCTKFVEGKLKAHLMSQDIPE
DWDKTPVKVLVGKNFEEVVFDPSKNVFVEFYAPWCGHCKQLTPIWEKLGEKYKDSADTIV
AKMDSTANEIEAVKVHSFPTLKFFPAGDEHKVIDYNGERTLEGFTKFLESGGKEGGAPAG
DDEDDPEADDIEDDTDGEDDDGHDEL
Download sequence
Identical sequences H2S5J6
ENSTRUP00000007668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]