SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000007669 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000007669
Domain Number 1 Region: 33-144
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.65e-36
Family PDI-like 0.0000255
Further Details:      
 
Domain Number 2 Region: 376-499
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.31e-32
Family PDI-like 0.00065
Further Details:      
 
Domain Number 3 Region: 241-374
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.48e-27
Family PDI-like 0.033
Further Details:      
 
Domain Number 4 Region: 153-253
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.26e-25
Family PDI-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000007669   Gene: ENSTRUG00000003279   Transcript: ENSTRUT00000007716
Sequence length 517
Comment pep:known_by_projection scaffold:FUGU4:scaffold_244:31696:38707:1 gene:ENSTRUG00000003279 transcript:ENSTRUT00000007716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKGVKKTQNKAMMKFLLLCTLVVASRAEIAEEDDVLVLKKSNFDEALKAHPNILVEFYAP
WCGHCNALAPQYAKAAATLKEEGSEVRLAKVDATEETDLAQEFGVRGYPTIKFFKGGDKD
SPKEYSAGRQAEDIVSWLKKRTGPAVASLTGVTEAESLIADNEVAVIGFFKDGSSADAKA
FEKAAEAIDEIPFAMTSDDAVFSKFEVSTDSVVLFKKFDEGRNTFDGEVTKENLLNFVKS
NQLPLVIEFTEQTAPKIFGGEIKSHILMFLPKAASDFQDKMDQFKKAAEGFKGQILFIFI
DSDIEDNQRILEFFGLKKEECPAIRLITLEDEMTKYKPESDAITTEGIIEFCTKFVEGKL
KAHLMSQDIPEDWDKTPVKVLVGKNFEEVVFDPSKNVFVEFYAPWCGHCKQLTPIWEKLG
EKYKDSADTIVAKMDSTANEIEAVKVHSFPTLKFFPAGDEHKVIDYNGERTLEGFTKFLE
SGGKEGGAPAGDDEDDPEADDIEDDTDGEDDDGHDEL
Download sequence
Identical sequences H2S5J7
ENSTRUP00000007669 31033.ENSTRUP00000007669 ENSTRUP00000007669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]