SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008384 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008384
Domain Number 1 Region: 29-493
Classification Level Classification E-value
Superfamily Sema domain 1.44e-130
Family Sema domain 0.0000134
Further Details:      
 
Domain Number 2 Region: 1339-1468,1663-1851
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.86e-50
Family p120GAP domain-like 0.027
Further Details:      
 
Domain Number 3 Region: 1032-1135
Classification Level Classification E-value
Superfamily E set domains 2.15e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.077
Further Details:      
 
Domain Number 4 Region: 945-1034
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000611
Family E-set domains of sugar-utilizing enzymes 0.082
Further Details:      
 
Domain Number 5 Region: 847-946
Classification Level Classification E-value
Superfamily E set domains 0.00000000000159
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 6 Region: 496-547
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000196
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 1151-1223
Classification Level Classification E-value
Superfamily E set domains 0.00000798
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 8 Region: 801-833
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000222
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008384   Gene: ENSTRUG00000003572   Transcript: ENSTRUT00000008434
Sequence length 1882
Comment pep:known_by_projection scaffold:FUGU4:scaffold_318:49520:148491:-1 gene:ENSTRUG00000003572 transcript:ENSTRUT00000008434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPTSCLHKIVLIVTLSSSEGQPTRFKRFAPAEWGLTHLAIHNKTGEVYVGAVNWIFKLSN
NLTKLRSHMTGPVVDNEKCYPPPSVQSCPYDLAQTPNVNKLLLIDYAQNRLIACGSTSQG
ICQFLRLDDLFKLGEPHHRKEHYLSSVAESGTMSGVIISSPHSPTSKLFIGTPIDGKSEY
FPTLSSRKLMENEENADMFSFVYQDEFVSSQLKIPSDTLSKFPAFDIYYVYSFSSEQFVY
YLTMQLDTQLTSPDASGEQFFTSKIVRLCVDDPKFYSYVEFPIGCTKDGVEYRLVQDAFL
ARPGRQLASSLGISENEDILFTIFSQGQKNRAKPPKESALCLFTLRKIKEKIKERIQSCY
KGEGKLSLPWLLNKELACINSPLQIDDNFCGQDFNQPLGGTSTIEGIPLFIDKDDGMTSV
AAYDYRSNTVAFVGTRNGKLKKILVNSSNRPAVIYEKVTVSEEGGPLLRDMLFSPDQQHI
YALTEKQVVRVPVESCEQYATCGECLGSRDPHCGWCVLHNVCSRKDRCERAGEPQRFASD
QRQCVELTVQPRNISVTMSEVQRLFLYLHRLCTCFMCQTANFDFDTQSRDILLQCVRVLT
EVTPKHDEFSALPRCKHSAGDKRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNG
SFPCHWCKYRHVCTQNANDCSFQEGRVNVSEDCPQILPSTQIYIPVGVTKPITLAAKNLP
QPQSGQRNYECVFHIQGETHNVPALRFNSTSIQCQKTAYMYEGNDISDLPVDLSVVWNGM
FVIDNPYNIKAHLYKCYALRDSCGMCLKANPRFECGWCVQEKKCSLRQECTPPESTWMHA
TTGNSRCAHPKIIKLHPETGPRQGGTMLTITGENLGLQFKDIQNGVRIGKVACIPQEDQY
ISAEQIVCQLNDATGYRVQEAQVEVCVRDCIHQDYKAVSTKAFTFVSPYFNRVQPSTGPL
SGGTRITIEGSHLNAGSAVFVKIGLHPCRFERGSSKEIVCVTPAGQAPGTTPVMVDINSA
ELRNPEVKFNYTDDPTILKIEPDWSIASGGTMLTITGTNLATIKEPKMRAKYGAVKSENN
CTVVNNTVMVCLAPSVAGSDKSFSEAGSSPDEIGFVMDNVVAVLVVNETFSYHPDPVFEP
LSSTGLLELKPSSPLILKGRNLIPSAPGNTKLNYTVLIGETPCVLTLSETQLLCEWPNLT
GEHKVTVRVGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLVIIIVLIAYKRKSRDA
DRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTQELDGAGIPFLEYRTYAMRVLFP
GIEDHPVLKEIEVPANVEKALTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIM
TALQGEMEYATAVLKQLLSDLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLK
ECAGEPLFMLYCAIKQQMEKGPIDSITGEARYSLSEDKLIRQQIDYKTLTLHCVNPENEN
APEVTVKTLNCDTVTQVKEKLLDAVYKGTPYSQRPKASDMDLEWRQGRMARIILQDEDVT
TKIDNDWKRLNTLAHYQVTDGSVIALVPKQNSAYNISNSSTITKSLSRYESMLRTASSPD
SLRSRTPMITPDLESGTKLWHLVKNHDHPDQREGDRGSKMVSEIYLTRLLATKGTLQKFV
DDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHSISDSDVRHTWKSNCLPLRFWVNVI
KNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKNWVE
RYYSDISRMSAISDQDMSAYLAEQSRLHVNQFNSMSALHEIYSYIVKYKDEILSALERDE
QARRQRLRSKLEQVIDTMALAS
Download sequence
Identical sequences H2S7L2
ENSTRUP00000008384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]