SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008516 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008516
Domain Number 1 Region: 147-454
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-99
Family Protein kinases, catalytic subunit 0.0000000001
Further Details:      
 
Domain Number 2 Region: 1-111
Classification Level Classification E-value
Superfamily PH domain-like 2.62e-22
Family Pleckstrin-homology domain (PH domain) 0.00000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008516   Gene: ENSTRUG00000003633   Transcript: ENSTRUT00000008567
Sequence length 482
Comment pep:known_by_projection scaffold:FUGU4:scaffold_102:132997:138719:-1 gene:ENSTRUG00000003633 transcript:ENSTRUT00000008567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKDKPQDSDLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWAEAIQMVADSLAKQEEEGILCS
PISQIENVNEEEMDTSISHYKRKFVQTMNDFDYLKLLGKGTFGKVILVKEKASGTYYAMK
ILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHL
SRERVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGI
TDTATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSTIDWQDLYDKK
LVPPFQPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMDAADNERRPHFPQFSYSASG
RE
Download sequence
Identical sequences H2S7Z2
31033.ENSTRUP00000008516 ENSTRUP00000008516 ENSTRUP00000008516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]