SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008822 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008822
Domain Number 1 Region: 88-312
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.01e-17
Family YhfI-like 0.06
Further Details:      
 
Domain Number 2 Region: 15-118
Classification Level Classification E-value
Superfamily ISP domain 0.0000000000409
Family Rieske iron-sulfur protein (ISP) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008822   Gene: ENSTRUG00000003756   Transcript: ENSTRUT00000008873
Sequence length 586
Comment pep:known_by_projection scaffold:FUGU4:scaffold_374:120994:130189:1 gene:ENSTRUG00000003756 transcript:ENSTRUT00000008873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKAQVVLLLDAEVVNSLQVGINFKKSPEDGKSYILYKSKSGLKACKNQCKHQGGLFIKDI
EDLDGRTVKCTKHNWKLNMLTMKYMNPPDSFMQDELEVEYLGDGGLQLVELNPPDPWLAN
PRERLVLKEGEVKVTYLTHACMELQLGERRFMFDPWLKGPAFARGWWLLHEPPADALDRL
CAADLIYISHIHSDHLSYPTLKVLSERRPDAPIYVGDTSRPVFWYLEQSQVKLTNINVVP
FGVWQNVDEHLRFMILMDGIHPEMDTCIIVEYKGHMILNTVDCTRPNGGRLPQSVDLMMS
DFAGGASGFPMTFYGGKYSDSWKADFIKTERKKLLNYKAELVKTLEPRIFCPFAGYFVEA
HPSDRYIKDTNVKNSAEALNALINKIRPDTLTWTPKPGSVLDLGLALSDPTNSGAIAFPP
ASTQIYKVSWEFDLYLDELRSAISSEIFKHQNWIQFYYTWAGFQNYNLVIRVIETDDKFV
HVTDGWDYLVDFLDLSFPKKRPEREHFYLELKNRLSVMRYVVLHGRLWDDLYIGFQNRIS
RDPDIYHHRFWNHFQTELPVTRPDWDQFLQLYEFNVTALLENCTTV
Download sequence
Identical sequences H2S8U6
ENSTRUP00000008822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]