SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000009149 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000009149
Domain Number 1 Region: 119-133,303-540
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-63
Family Nuclear receptor ligand-binding domain 0.000000224
Further Details:      
 
Domain Number 2 Region: 51-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.77e-28
Family Nuclear receptor 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000009149
Domain Number - Region: 8-69
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0103
Family Rad50 coiled-coil Zn hook 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000009149   Gene: ENSTRUG00000003884   Transcript: ENSTRUT00000009203
Sequence length 543
Comment pep:known_by_projection scaffold:FUGU4:scaffold_15:34765:37272:-1 gene:ENSTRUG00000003884 transcript:ENSTRUT00000009203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPGSHLQELQPDLHRVDDQTEDMLAVEQSYYHAAQELKAEVDGTTESEESCPVCGDRV
SGYHYGLLTCESCKGFFKRSVQNNKDYTCAEQQSCPMNLSQRKRCPFCRFQKCLAVGMKR
EAVRADRMRGGRNKFGPLYRRDRQMKQQKVFYHTNADPHRMKAEMTQIQRPTPPNDLHLM
SSHTSSDAARQPGYASGTSQSAVPMPLDCTANSDVFTSPSLPYPGLYHHTLPGYLQDKGE
LPYSYSMAATMYPLHQPPNSSYAYRSTAPSSSTSSPSSALSSSAPVPKTSSQSPDACPPS
TVMHNFLSQLMDGEQDESQLCAKVVASLQREQANRGKHDRLNTFSIMCKMADQTLFGLVE
WARNSALFKELKVEDQMVLLQSCWSELLVLDHLCRQVIYSKEGCIYLVSGQQIEVSTILS
QAGATLSGLVSRTQDLVSKLKALQLDRQEFVCLKYLVLFNPDVKSVQSRRQVEQTQERVN
RALMEHTQQRHPRQSDKFGQLLLRLPEVRSISLQVEEYLYQRHLLGDLPCNSLLTEMLHT
KHS
Download sequence
Identical sequences H2S9S3
31033.ENSTRUP00000009149 ENSTRUP00000009149 ENSTRUP00000009149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]