SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000009150 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000009150
Domain Number 1 Region: 91-105,253-490
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-63
Family Nuclear receptor ligand-binding domain 0.000000224
Further Details:      
 
Domain Number 2 Region: 23-106
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.26e-28
Family Nuclear receptor 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000009150   Gene: ENSTRUG00000003884   Transcript: ENSTRUT00000009204
Sequence length 493
Comment pep:known_by_projection scaffold:FUGU4:scaffold_15:34765:36783:-1 gene:ENSTRUG00000003884 transcript:ENSTRUT00000009204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIIDYHAAQELKAEVDGTTESEESCPVCGDRVSGYHYGLLTCESCKGFFKRSVQNNKDYT
CAEQQSCPMNLSQRKRCPFCRFQKCLAVGMKREAVRADRMRGGRNKFGPLYRRDRQMKQQ
KVFYHTNADPHRMKAEMTQIQRPTPPNDLHSAVPMPLDCTANSDVFTSPSLPYPGLYHHT
LPGYLQDKGELPYSYSMAATMYPLHQPPNSSYAYRSTAPSSSTSSPSSALSSSAPVPKTS
SQSPDACPPSTVMHNFLSQLMDGEQDESQLCAKVVASLQREQANRGKHDRLNTFSIMCKM
ADQTLFGLVEWARNSALFKELKVEDQMVLLQSCWSELLVLDHLCRQVIYSKEGCIYLVSG
QQIEVSTILSQAGATLSGLVSRTQDLVSKLKALQLDRQEFVCLKYLVLFNPDVKSVQSRR
QVEQTQERVNRALMEHTQQRHPRQSDKFGQLLLRLPEVRSISLQVEEYLYQRHLLGDLPC
NSLLTEMLHTKHS
Download sequence
Identical sequences H2S9S4
ENSTRUP00000009150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]