SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000009516 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000009516
Domain Number 1 Region: 247-365
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.95e-54
Family Calsequestrin 0.00000177
Further Details:      
 
Domain Number 2 Region: 23-145
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.47e-22
Family Calsequestrin 0.0000161
Further Details:      
 
Domain Number 3 Region: 146-244
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.05e-21
Family Calsequestrin 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000009516   Gene: ENSTRUG00000004018   Transcript: ENSTRUT00000009571
Sequence length 406
Comment pep:known_by_projection scaffold:FUGU4:scaffold_64:98848:102004:-1 gene:ENSTRUG00000004018 transcript:ENSTRUT00000009571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGRFSLFFLCLHLTFLCNAEEGLEFPNFDGKDRVLDINERNYKKALKRYHLLCLFYHEPI
PTNKGLQKRFQMTELVLELTAQVLENKDIGFGMVDSLKDAKVAKKLGLEEVGSLYIFKDD
RVIEFDGEFSSDTLVEFLLDVLEDPVEMINNAMELRAFERMEEDIRLIGYFKGEDSYFKA
FQQASELFQPYIKFFATFDKSTAKHLSLKMNEVNFYEPFMEEPAILPGRPLSEMDIVEFV
KQHRRATLRKLRAENMFETWEDDMDGIHIVAFAEEEDPDGYEFLEILKDVARDNTNNPEL
SIVWIDPDDFPLLTTYWEKTFKLDLFRPQIGVVNVTDADSVWLDMSNDEDLPTAEELEDW
IEDVLSGRVNTEDDDETASDQENSYIYVTEDSYENDEQDEEYDSED
Download sequence
Identical sequences H2SAT8
ENSTRUP00000009516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]