SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000009517 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000009517
Domain Number 1 Region: 307-453
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.46e-44
Family Calsequestrin 0.00000254
Further Details:      
 
Domain Number 2 Region: 24-146
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.16e-21
Family Calsequestrin 0.0000161
Further Details:      
 
Domain Number 3 Region: 237-304
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000727
Family Calsequestrin 0.00039
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000009517
Domain Number - Region: 147-178
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0168
Family Calsequestrin 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000009517   Gene: ENSTRUG00000004018   Transcript: ENSTRUT00000009572
Sequence length 494
Comment pep:known_by_projection scaffold:FUGU4:scaffold_64:98848:101925:-1 gene:ENSTRUG00000004018 transcript:ENSTRUT00000009572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HICLALVSSLCLHLTFLCNAEEGLEFPNFDGKDRVLDINERNYKKALKRYHLLCLFYHEP
IPTNKGLQKRFQMTELVLELTAQVLENKDIGFGMVDSLKDAKVAKKLGLEEVGSLYIFKD
DRVIEFDGEFSSDTLVEFLLDVLEDPVEMINNAMELRAFERMEEDIRLIGYFKGEDSYDS
RLSYPLCLRSSFKSDCNYSSKRSETVQLSSSPTLFTPDFFERLKKKSNFSFSFLISDFKA
FQQASELFQPYIKFFATFDKSTAKHLSLKMNEVNFYEPFMEEPAILPGRPLSEMDIVEFV
KQHRRATLRKLRAENMFETWEDDMDGIHIVAFAEEEDPDGYEFLEILKDVARDNTNNPEL
SIVWIDPDDFPLVLFFSPYRQLTTYWEKTFKLDLFRPQIGVVNVTDVSNLFSSCKPEVAC
GLFNEADSVWLDMSNDEDLPTAEELEDWIEDVLSGRVNTEDDDETASDQENSYIYVTEDS
YENDEQDEEYDSED
Download sequence
Identical sequences H2SAT9
ENSTRUP00000009517 ENSTRUP00000009517 31033.ENSTRUP00000009517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]