SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000009519 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000009519
Domain Number 1 Region: 250-323
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.3e-31
Family Calsequestrin 0.0000548
Further Details:      
 
Domain Number 2 Region: 26-148
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.25e-22
Family Calsequestrin 0.0000161
Further Details:      
 
Domain Number 3 Region: 149-247
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.07e-21
Family Calsequestrin 0.00011
Further Details:      
 
Domain Number 4 Region: 344-396
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.03e-17
Family Calsequestrin 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000009519   Gene: ENSTRUG00000004018   Transcript: ENSTRUT00000009574
Sequence length 411
Comment pep:known_by_projection scaffold:FUGU4:scaffold_64:98929:101931:-1 gene:ENSTRUG00000004018 transcript:ENSTRUT00000009574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHICLALVSSLCLHLTFLCNAEEGLEFPNFDGKDRVLDINERNYKKALKRYHLLCLFYH
EPIPTNKGLQKRFQMTELVLELTAQVLENKDIGFGMVDSLKDAKVAKKLGLEEVGSLYIF
KDDRVIEFDGEFSSDTLVEFLLDVLEDPVEMINNAMELRAFERMEEDIRLIGYFKGEDSY
FKAFQQASELFQPYIKFFATFDKSTAKHLSLKMNEVNFYEPFMEEPAILPGRPLSEMDIV
EFVKQHRRATLRKLRAENMFETWEDDMDGIHIVAFAEEEDPDGYEFLEILKDVARDNTNN
PELSIVWIDPDDFPLVLSHLWLCFSNRCFDSKLLTRFFSPYRQLTTYWEKTFKLDLFRPQ
IGVVNVTDADSVWLDMSNDEDLPTAEELEDWIEDVLSGRVNTEDDDETASD
Download sequence
Identical sequences H2SAU1
ENSTRUP00000009519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]