SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000010565 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000010565
Domain Number 1 Region: 383-565
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-56
Family SPRY domain 0.0000217
Further Details:      
 
Domain Number 2 Region: 17-81
Classification Level Classification E-value
Superfamily RING/U-box 2.59e-19
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Domain Number 3 Region: 167-232
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000168
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000010565   Gene: ENSTRUG00000004443   Transcript: ENSTRUT00000010623
Sequence length 569
Comment pep:known_by_projection scaffold:FUGU4:scaffold_305:214050:219610:1 gene:ENSTRUG00000004443 transcript:ENSTRUT00000010623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKCLQSMSSPGGRLLSEEQFSCSICLEVFVEPVSTPCGHSFCKACLQGYWNHSKKFVCPM
CKKCYSKKPEMSVNRVLAEISTQFQGLAMTGGATSGGSVMNLSSDAGRVASPGPDTGEFA
QSGEVPCDACIGRKLKAHKSCLNCLGSFCETHLRHHKKVKSLISHRLVEPTFHLEEKICK
KHERLLDHYCRTDHTCICTSCGDSMHKSHDIVSTDHEWKKKMNNLGKKRSELKHLIKERT
KKLEEIKQSIKVIKSSAQKELEESWQVYAELQRMVEQSQAELVEAIAMKQREAERHAQEL
ARGLENELSQLKRRSNELEAHAKMQDRVLFLQKLTTLSPPPEPSDWSAVSINTDLYLGTI
RSSVNNLINRFQEELKRLYGKELRKVQNYSSEVILDPGTAQKNLVVSDDGRQVKYEDRKT
NHSEGAKRFSPALFVLGREGLSSGRHYWEVDIGRKTAWTLGVASALARRKGEISLSPEGG
FWCLWLKSGEVKALASCRLPLMLQSPPTKLGIFLDYEEGQISFYDVKARLHLYTFSDTFN
ESLYPIFSPCLSQEGKNSAPIIITQVKHT
Download sequence
Identical sequences H2SDT4
31033.ENSTRUP00000010565 ENSTRUP00000010565 ENSTRUP00000010565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]