SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000010762 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000010762
Domain Number 1 Region: 363-535
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-51
Family SPRY domain 0.00044
Further Details:      
 
Domain Number 2 Region: 142-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.41e-16
Family B-box zinc-binding domain 0.00062
Further Details:      
 
Domain Number 3 Region: 11-65
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000495
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000010762
Domain Number - Region: 181-308
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0023
Family FCH domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000010762   Gene: ENSTRUG00000004531   Transcript: ENSTRUT00000010820
Sequence length 538
Comment pep:known_by_projection scaffold:FUGU4:scaffold_331:45933:49179:1 gene:ENSTRUG00000004531 transcript:ENSTRUT00000010820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAPLAPMSSDQDSCYLCKEHLRDPVSIPCGHVFCSICLKTYWDHADHTGSFLCPQCRVTY
NKRPTPRRVGGSRYSTLPRDSFPPPPPSPDYNYAGPQDVGCDICIGKKHKAVKTCLMCLA
SYCEKHLKPHFESATFKRHKLVDEIGHLDRQICPQHQKGLELYCRTDQMCICVLCTVKEH
KGHDMVSAEQERAEEQQRLGATQADVQEKIHDRLKQMEELKQAVDALKNSAQRALQECEK
TFSDMIRAIERMQQEMAKLISSNKRAALNNAEGHLERLTHEISDLKRRDNEITQLSRTED
HIHFIQERRVRGAGEASRGRTRGGELQVLAVRDISVCVTNGPRPQGLLRSSILTSFRMKD
RRREEERDLTLDPNTAYRQLYLSRGNRKATLKRDPQAYHDSAARFDSLPQVLCVEPLSGG
AYYWEVDWSGEGAAIGVTYKGIKRAGYGDGCRIGYNRKSWSLFCSDSSYSARHSKDQLEI
TAPYSSRIGVFLDHAGGTLSFYAVGESMSLIHRFKASFGEPVYPGFWVWYESAITIIQ
Download sequence
Identical sequences H2SED1
ENSTRUP00000010762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]