SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011022 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011022
Domain Number 1 Region: 784-974
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.35e-64
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000912
Further Details:      
 
Domain Number 2 Region: 47-429
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.75e-50
Family L-arabinose binding protein-like 0.00045
Further Details:      
 
Domain Number 3 Region: 509-750
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.11e-42
Family Protein kinases, catalytic subunit 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011022   Gene: ENSTRUG00000004638   Transcript: ENSTRUT00000011081
Sequence length 1056
Comment pep:known_by_projection scaffold:FUGU4:scaffold_497:64638:73573:1 gene:ENSTRUG00000004638 transcript:ENSTRUT00000011081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTTMLSAHSLLQLGVLVAAAAANRILDECLKGDKKYAMNVVLLEDNTYEWSRPFVQAAVE
RAIEEDRLENDRHGIDFNLTANYNGFNTTVYNRQGCGSSTCEGVAILKMLHSNGELGCVM
LGPSCTFATFQLVDDEIGLSLSIPVISAGSFGLSCDYKSKLTRILPPAHKISDLLIHFVK
EELVFKREWKKVYVYKNSNASEDCFWYTNALEAASANFAQNIKREMLREESDLVKILPTT
NRHSNIFIMCGSPNDIVSVKSKVKGQITEETLIILLDIYNPAYYINVTSSQAMQDVLVIT
LPQRNYTYGSNLTFNDTINDYVAGYHDGVLLFGKVLRERLLSQKNPRKALDVPLSDNPFG
NASFHGMGGYYVLDEYGDRDVNFSIIYTSTLTGKFETLVVFDTSQNKTTFIAANPALFWI
GAVLPDDEPGLNFQDWIMIALSVSVVVVTAIALIFYRQNRKERLMQKKWSHIDPQLFCPL
DEKEVSLKIEEDRRKDSTYFSRRCRYDKKLLGIDYYNLTKFYGTVKFEYSVFGVFELCQR
GSLRFILNDKISYPDETFMDMEFKISVMYDIAKGMSYLHSSNIQVHGRLKSTNCVVDNRM
VVKITDFGCHTILNPGRDLWTAPEHLRKNSVSQKGDVYSYAIIAHEIIMRRTPFYTQSCS
NPAEKIYRVQFPSGMGFFRPDLNFEGTSEREIELCMLISNCWDEDPERRPDFKKIELTLG
KIFSNLHNQASETYMDNLIRRLQMYSRTLEHLVEERTALYKAERDRADRLNFMLLPGPVV
RSLKETGKVEPELFEQVTIYFSDIVGFTTLCHYSTPMEVVDMLNDIYKNFDSILDHHDVY
KVETIGDAYMVASGLPKRNGDRHAVDIAEMALDMLSFVKTFELLHLPGIPLWIRIGVHSG
PCAAGVVGNKMPRYCLFGDTVNTASRMESTGLPLRIHVSQSTINILQRTDCKFEYEKRGE
TYLKGKGKEMTYWLTGVLGKTYNLPTPPTAENFQRLQQDLAEMIVSSLENREDRGSSLKK
TLSSEVHKREASGSLQSDGPPEYFHLAVTDNTSTFL
Download sequence
Identical sequences H2SF41
ENSTRUP00000011022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]