SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011023 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011023
Domain Number 1 Region: 813-1003
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.4e-64
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000912
Further Details:      
 
Domain Number 2 Region: 44-430
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.81e-49
Family L-arabinose binding protein-like 0.00045
Further Details:      
 
Domain Number 3 Region: 509-779
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-45
Family Protein kinases, catalytic subunit 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011023   Gene: ENSTRUG00000004638   Transcript: ENSTRUT00000011082
Sequence length 1085
Comment pep:known_by_projection scaffold:FUGU4:scaffold_497:64647:73573:1 gene:ENSTRUG00000004638 transcript:ENSTRUT00000011082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSAHSLLQLGVLVAAAAANRILDECLKGDKKYAMNVVLLEDNTYEWSRPFVQAAVERAI
EEDRLENDRHVCDAGIDFNLTANYNGFNTTVYNRQGCGSSTCEGVAILKMLHSNGELGCV
MLGPSCTFATFQLVDDEIGLSLSIPVISAGSFGLSCDYKSKLTRILPPAHKISDLLIHFV
KEELVFKREWKKVYVYKNSNASEDCFWYTNALEAASANFAQNIKREMLREESDLVKILPT
TNRHSNIFIMCGSPNDIVSVKSKVKGQITEETLIILLDIYNPAYYINVTSSQAMQDVLVI
TLPQRNYTYGSNLTFNDTINDYVAGYHDGVLLFGKVLRERLLSQKNPRKALDVPLSDNPF
GNASFHGMGGYYVLDEYGDRDVNFSIIYTSTLTGKFETLVVFDTSQNKTTFIAANPALFW
IGAVLPDDEPENYNGLNFQDWIMIALSVSVVVVTAIALIFYRQNRKERLMQKKWSHIDPQ
LFCPLDEKEVSLKIEEDRRKDSTYFSRRCRYDKKPVILKELKQTDGDFSEDQRIELNTLL
GIDYYNLTKFYGTVKFEYSVFGVFELCQRGSLRFILNDKISYPDETFMDMEFKISVMYDI
AKGMSYLHSSNIQVHGRLKSTNCVVDNRMVVKITDFGCHTILNPGRDLWTAPEHLRKNSV
SQKGDVYSYAIIAHEIIMRRTPFYTQSCSNPAEKIYRVQFPSGMGFFRPDLNFEGTSERE
IELCMLISNCWDEDPERRPDFKKIELTLGKIFSNLHNQASETYMDNLIRRLQMYSRTLEH
LVEERTALYKAERDRADRLNFMLLPGPVVRSLKETGKVEPELFEQVTIYFSDIVGFTTLC
HYSTPMEVVDMLNDIYKNFDSILDHHDVYKVETIGDAYMVASGLPKRNGDRHAVDIAEMA
LDMLSFVKTFELLHLPGIPLWIRIGVHSGPCAAGVVGNKMPRYCLFGDTVNTASRMESTG
LPLRIHVSQSTINILQRTDCKFEYEKRGETYLKGKGKEMTYWLTGVLGKTYNLPTPPTAE
NFQRLQQDLAEMIVSSLENREDRGSSLKKTLSSEVHKREASGSLQSDGPPEYFHLAVTDN
TSTFL
Download sequence
Identical sequences H2SF42
31033.ENSTRUP00000011023 ENSTRUP00000011023 ENSTRUP00000011023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]