SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011119 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011119
Domain Number 1 Region: 338-503
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-63
Family SPRY domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 9-78
Classification Level Classification E-value
Superfamily RING/U-box 9.72e-20
Family RING finger domain, C3HC4 0.0062
Further Details:      
 
Domain Number 3 Region: 129-185
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000763
Family B-box zinc-binding domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011119   Gene: ENSTRUG00000004683   Transcript: ENSTRUT00000011179
Sequence length 513
Comment pep:novel scaffold:FUGU4:scaffold_305:221713:224775:1 gene:ENSTRUG00000004683 transcript:ENSTRUT00000011179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTGNLSEEQVHCSICLDVFTNPVSIPCGHNFCQSCIIGYWKTSPLYQCPMCKKSFYKR
PDISVNTVLREIAEQFKEIRLTSSWEEVLCDICLGEGRPLAVKSCLVCLTSYCDEHLKSH
STRFTKHKLIEPVANMADRMCPKHERLLELFCKKDQTCVCVLCTETDHRAHYTIPVEREW
TEKKLRTAGKTCVAIKAQLKRTEIDVQQMIQDREKKMEEIKHSVELNKVSKWVTNRTQAE
LVVSIEEKQRQTERWAAGFITELEEEIAGLTRRKKDLENMARTDHIHFLKNFPALSGSPS
VKDWSETSVSPDICIGMIRKSVTKLKTTLQEMIDKLAESVDVTLDPDSANPWLQLSQDRR
QVRHLGAWQDLPDHPDRFDTVVIVLAREGFTSGRHYWEVQVGDKDDWYLGVARSSINRKG
RISVSTTQGYWALAMKKGQGYRVSTSPPTLLALEPKPKRVGIYLDYEEGQVSFYDVRART
HIYTLKDTFTEKVLPFFYLYCSDKTSDTIAICP
Download sequence
Identical sequences H2SFD8
ENSTRUP00000011119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]