SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011122 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011122
Domain Number 1 Region: 386-554
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-64
Family SPRY domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 7-76
Classification Level Classification E-value
Superfamily RING/U-box 4.86e-20
Family RING finger domain, C3HC4 0.0065
Further Details:      
 
Domain Number 3 Region: 137-197
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000139
Family B-box zinc-binding domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011122   Gene: ENSTRUG00000004683   Transcript: ENSTRUT00000011182
Sequence length 560
Comment pep:novel scaffold:FUGU4:scaffold_305:221719:224763:1 gene:ENSTRUG00000004683 transcript:ENSTRUT00000011182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTGNLSEEQVHCSICLDVFTNPVSIPCGHNFCQSCIIGYWKTSPLYQCPMCKKSFYKRPD
ISVNTVLREIAEQFKEIRTLPSFPSSSLLTSSWEEVLCDICLGEGRPLAVKSCLVCLTSY
CDEHLKSHSTRFTKHKLIEPVANMADRMCPKHERLLELFCKKDQTCVCVLCTETDHRAHY
TIPVEREWTEKKAQLKRTEIDVQQMIQDREKKMEEIKHSVELNKASAQREIEESMQVFSE
LVRSIQRTQAELVVSIEEKQRQTERWAAGFITELEEEIAGLTRRKKDLENMARTDHIHFL
KNFPALSGSPSVKDWSETSVSPDICIGMIRKSVTKLKTTLQEMIDKLAESGEIYFIIRIY
LLVTRVDDKWMGRMMIFNHPRTNLQINQYFVDVTLDPDSANPWLQLSQDRRQVRHLGAWQ
DLPDHPDRFDTVVIVLAREGFTSGRHYWEVQVGDKDDWYLGVARSSINRKGRISVSTTQG
YWALAMKKGQGYRVSTSPPTLLALEPKPKRVGIYLDYEEGQVSFYDVRARTHIYTLKDTF
TEKVLPFFYLYCSDKTSDTI
Download sequence
Identical sequences H2SFE1
ENSTRUP00000011122 ENSTRUP00000011122 31033.ENSTRUP00000011122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]