SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Takifugu rubripes 76_4 > ENSTRUP00000011243

Domain assignment for ENSTRUP00000011243 from Takifugu rubripes 76_4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSTRUP00000011243
Domain Number 1 Region: 415-675
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-53
Family YWTD domain 0.0000000676
Further Details:      
 
Domain Number 2 Region: 121-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000628
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 3 Region: 207-247
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000838
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 4 Region: 4-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 245-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000628
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 6 Region: 43-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 7 Region: 165-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 8 Region: 80-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 9 Region: 369-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000401
Family EGF-type module 0.0013
Further Details:      
 
Domain Number 10 Region: 290-326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000694
Family LDL receptor-like module 0.00041
Further Details:      
 
Domain Number 11 Region: 333-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000072
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 12 Region: 678-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000519
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011243   Gene: ENSTRUG00000004731   Transcript: ENSTRUT00000011303
Sequence length 846
Comment pep:known_by_projection scaffold:FUGU4:scaffold_216:275135:291402:-1 gene:ENSTRUG00000004731 transcript:ENSTRUT00000011303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
GTKTECEASQFQCGNGRCILSVWQCDGEDDCTDGSDENSCVKKTCAETDFVCHNGQCVPK
RWHCDGEPDCEDGSDESLDICHTRTCRLNEVSCGTGSTLCIPVFWKCDGEKDCDNGEDEV
NCGNVTCAPNEFTCASGRCISRNFVCNGEDDCSDGSDELDCAPSSCAPSEFQCGNSSCIP
ASWVCDDDVDCQDQSDESPSHCGRHPTPPAKCSSSEMQCRSGECIHKKWRCDGDRDCKDG
TDEANCPVRSCGLDQFRCDDGSCIQGSRQCNGLRDCADGSDEVNCKNVTQCSGPEKFKCR
SGDCIEMSKVCNKVRDCPDWSDEPIKECNVNECLLNNGGCSHICKDMVIGFECDCTPGLQ
LIDHKTCGDINECLNPGICSQICINLKGGYKCECHNGYQMDPTTGVCKAVGKEPCLIFTN
RRDIRRLGLERKEYTQLVEQQRNAVALDADFNQQTIFWADLGQKAIFSAVLDKRGDIGVH
TKVVDNVQTPVGIAVDWIYKNLYWSDLGTKTISVSNFNGTKVKVLFDRSLKEPASIAVDP
LSGFLYWSDWGEPAKIEKSGMNGVDRQVLVVSDLQWPNGITLDLIKGRLYWVDSKLHMLC
SVDLNGDNRKKVLQSSEYLAHPFALTVFEDRVFWTDGENQAIYGANKFSGSDVATLASNL
NDPQDIIVYHELIQLSGTNWCAEKGENGGCSYMCLPAPQINKHSPKYTCVCPDGQELAAD
GLRCIPVCSNQTDASTKDPSEDAGKALSQPPAEANVSTSIQVDSTARGSAAAWAILPVLL
LAMAAAGGYVMWRNWQLKNQKSMNFDNPVYLKTTEEDLNIDITRHGANVGHTYPAISIVS
TDDDLS
Download sequence
Identical sequences H2SFR2
ENSTRUP00000011243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.