SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012013 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012013
Domain Number 1 Region: 648-842
Classification Level Classification E-value
Superfamily Sec7 domain 6.93e-71
Family Sec7 domain 0.00000276
Further Details:      
 
Domain Number 2 Region: 416-592,1102-1504,1631-1771
Classification Level Classification E-value
Superfamily ARM repeat 3.4e-27
Family Armadillo repeat 0.082
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000012013
Domain Number - Region: 27-156
Classification Level Classification E-value
Superfamily ARM repeat 0.0604
Family GUN4-associated domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012013   Gene: ENSTRUG00000005014   Transcript: ENSTRUT00000012073
Sequence length 1790
Comment pep:known_by_projection scaffold:FUGU4:scaffold_343:166118:199064:1 gene:ENSTRUG00000005014 transcript:ENSTRUT00000012073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEESKTKSMFLSRALEKILLDKEVKRSQHDQLRKACQVALDEIKTEQYQQKDSNVVQPRT
SYIEAEKYVLPFELACQSKSPRIVSTSLDCLQKLIAYGHITGNALDSRMPGKRLIDRLVE
TICNCFQGTQTDEGVQLQIIKALLTIVTSPHIEIHEGTVLLTVRTCYNIYLASRNLINQT
TAKATLAQMLNVIFTRMETQAALDASELEKDHLCLAQQTHSPVLSDWHTVSPRSDYTSTP
ESQSSPYVVADSVGETTTYTTVSVSPPLASDGDQDKETNTTSINGEQQGSSASIKGGNGE
PVTPSSDAILSLHIRHTAEPALSNKDEQLPHLTDERKQVPPSRTGTVQINDITDQASVSS
TEMLDADALQEPQNTASFCHILQKDAFLVFRSLCKLSMKPLADGPPDPKSHELRSKIISL
QLLLSLLQGAGPVFRAHDMFANAIKQYLCVALSKNGVSSVPEVFELSLAIFLTLLSHFKI
HLKMQIEVFFREIFLTILETSTSSFEHKWMVIQTLTRICADAQCVVDIYVNYDCHLNAAN
IFERLVNDLSKIAQGRSGQELGMTSLQELSLRKKGLECLVSILKCMVEWSKDMYVNPHLQ
SNLGQENLSNTEGGALRLPDQLAGRRDSVSSLDSTMSSSLPASQTDLPEQYEVIKQQKDI
IEHGIELFNKKPKRGIQYLQDQSMLGVTAEDIAQFLHQEERLDTTQVGEFLSENFKFNKE
VMYCYVDQLDFCGWDFVSALRTFLEGFRLPGEAQKIDRLMEKFAARFLECNQGQTLFASA
DTAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYDEIAGKK
IAIKESKEFSIMPKSTKQSVANEKQRRLLYNMEMEQMAKTAKALMEAVSHAQAPFFSATH
LEHVRPMFKLAWTPLLAAFSVGLQDCDDLEVASLCLEGIRCAIRIACIFNMQLERDAYVQ
ALARFTLLTACSSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILRCISQLELAQLIG
TGVKPRYSSGVVREKELNIKGLPAGVEEFMPLGLGNMVGNQEKRQMVHIQESVGETSSQS
VVVAVDRIFTGSTRLDGNAIVDFVRWLCAVSMDELASAHQPRMFSLQKIVEISYYNMNRI
RLQWSRIWQVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPF
EHIVKKNRSPTIRDMVIRCVAQMVNSQASNIRSGWKNIFSVFHQAASDHDETIVELAFQT
TGHIVMNTFNDHFAAAIDSFQDVVKCLAEFVCNTAFPDTSMEAIRLIRQCARYVSQRPQT
LREYTSDDMNVAPGDRVWVRGWFPILFELSCIISRCKLDVRTRGLTVMFEIMKTYGHTFE
RHWWQDLFRIVFRIFDNMKLPEQQTEKTEWMTTTCNHALYAICDVFTQFYEPLSEILLAD
IFTQLQWCVRQDNEQLARSGTNCLENLVILNGEKFNNEVWNMTCSCMLEIFQSTSPHTLL
AWRPAGQEEETVDGKYFDTDFDSQSQSSYDKALSERGPSQMSSEDTWKCKSITKVSDQKL
FAGLLIKCVVQLELIQTIDNIVFYPATSKKEDAEHMAAAQRNALGELDAEADPGPDQGMY
MYMTSAHLFKLLDCLVESHTFAKNFNSNSEQRTALWRAGFKGKSKPNLLKQETCSLACSL
RILFKMYSDPKLKDSWPDIQTRLLLMCTQALDYFISLTSESHREAWNSLLMLLLTKTLQL
PNDKFKPHASCYYPHLCEMIQFDLIPELRAALGCFFLRIGHIFHISIPEE
Download sequence
Identical sequences H2SHY1
ENSTRUP00000012013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]