SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012014 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012014
Domain Number 1 Region: 641-835
Classification Level Classification E-value
Superfamily Sec7 domain 6.93e-71
Family Sec7 domain 0.00000276
Further Details:      
 
Domain Number 2 Region: 74-147,370-585,1095-1497,1624-1764
Classification Level Classification E-value
Superfamily ARM repeat 6.51e-28
Family MIF4G domain-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012014   Gene: ENSTRUG00000005014   Transcript: ENSTRUT00000012074
Sequence length 1783
Comment pep:known_by_projection scaffold:FUGU4:scaffold_343:166118:199064:1 gene:ENSTRUG00000005014 transcript:ENSTRUT00000012074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEESKTKSMFLSRALEKILLDKEVKRSQHDQLRKACQVALDEIKTEQYQQKDSNVVQPRT
SYIEAEKYVLPFELACQSKSPRIVSTSLDCLQKLIAYGHITGNALDSRMPGKRLIDRLVE
TICNCFQGTQTDEGVQLQIIKALLTIVTSPHIEIHEGTVLLTVRTCYNIYLASRNLINQT
TAKATLAQMLNVIFTRMETQAALDASELEKDHLCLAQQTHSPVLSDWHTVSPRSDYTSTP
ESQSSPYVVADSVGETTTYTTVSVSPPLASDGDQDKETNTTSINGEQQGSSASIKGGNGE
PVTPSSARDREHFWLREPYEQLPHLTDERKQVPPSRTGTVQINDITDQASVSSTEMLDAD
ALQEPQNTASFCHILQKDAFLVFRSLCKLSMKPLADGPPDPKSHELRSKIISLQLLLSLL
QGAGPVFRAHDMFANAIKQYLCVALSKNGVSSVPEVFELSLAIFLTLLSHFKIHLKMQIE
VFFREIFLTILETSTSSFEHKWMVIQTLTRICADAQCVVDIYVNYDCHLNAANIFERLVN
DLSKIAQGRSGQELGMTSLQELSLRKKGLECLVSILKCMVEWSKDMYVNPHLQSNLGQEN
LSNTEGGALRLPDQLAGRRDSVSSLDSTMSSSLPASQTDLPEQYEVIKQQKDIIEHGIEL
FNKKPKRGIQYLQDQSMLGVTAEDIAQFLHQEERLDTTQVGEFLSENFKFNKEVMYCYVD
QLDFCGWDFVSALRTFLEGFRLPGEAQKIDRLMEKFAARFLECNQGQTLFASADTAYVLA
YSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYDEIAGKKIAIKESK
EFSIMPKSTKQSVANEKQRRLLYNMEMEQMAKTAKALMEAVSHAQAPFFSATHLEHVRPM
FKLAWTPLLAAFSVGLQDCDDLEVASLCLEGIRCAIRIACIFNMQLERDAYVQALARFTL
LTACSSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILRCISQLELAQLIGTGVKPRY
SSGVVREKELNIKGLPAGVEEFMPLGLGNMVGNQEKRQMVHIQESVGETSSQSVVVAVDR
IFTGSTRLDGNAIVDFVRWLCAVSMDELASAHQPRMFSLQKIVEISYYNMNRIRLQWSRI
WQVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIVKKN
RSPTIRDMVIRCVAQMVNSQASNIRSGWKNIFSVFHQAASDHDETIVELAFQTTGHIVMN
TFNDHFAAAIDSFQDVVKCLAEFVCNTAFPDTSMEAIRLIRQCARYVSQRPQTLREYTSD
DMNVAPGDRVWVRGWFPILFELSCIISRCKLDVRTRGLTVMFEIMKTYGHTFERHWWQDL
FRIVFRIFDNMKLPEQQTEKTEWMTTTCNHALYAICDVFTQFYEPLSEILLADIFTQLQW
CVRQDNEQLARSGTNCLENLVILNGEKFNNEVWNMTCSCMLEIFQSTSPHTLLAWRPAGQ
EEETVDGKYFDTDFDSQSQSSYDKALSERGPSQMSSEDTWKCKSITKVSDQKLFAGLLIK
CVVQLELIQTIDNIVFYPATSKKEDAEHMAAAQRNALGELDAEADPGPDQGMYMYMTSAH
LFKLLDCLVESHTFAKNFNSNSEQRTALWRAGFKGKSKPNLLKQETCSLACSLRILFKMY
SDPKLKDSWPDIQTRLLLMCTQALDYFISLTSESHREAWNSLLMLLLTKTLQLPNDKFKP
HASCYYPHLCEMIQFDLIPELRAALGCFFLRIGHIFHISIPEE
Download sequence
Identical sequences H2SHY2
ENSTRUP00000012014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]