SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012109 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012109
Domain Number 1 Region: 126-406
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-73
Family Nuclear receptor ligand-binding domain 0.00000000212
Further Details:      
 
Domain Number 2 Region: 73-153
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.11e-27
Family Nuclear receptor 0.0000168
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000012109
Domain Number - Region: 422-431
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0126
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012109   Gene: ENSTRUG00000005047   Transcript: ENSTRUT00000012169
Sequence length 501
Comment pep:known_by_projection scaffold:FUGU4:scaffold_66:235479:249934:-1 gene:ENSTRUG00000005047 transcript:ENSTRUT00000012169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDCMEALGLGPRQLYDVTSHGACMLRKASPFFAGLDTFAWTSSASVQSVETQSTSSEEM
VPSSPSPPPPPRVYKPCFVCQDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCQ
INKVTRNRCQYCRLQKCFEVGMSRKETVRNDRNKKKKDVKEEVVLPESYELSGELEELVN
KVSKAHQETFPSLGQLGKYTTNSSSDHRVQLDLGLWDKFSELSTKCIIKIVEFAKRLPGF
TSLTIADQITLLKSACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLV
FAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALKIYARRRRPN
KPHMFPRMLMKITDLRGISTKGAERAVTLKTEIPGPMPPLIREMLENPEAFEDQTESNDS
PPPPPPPPPPPPSTLVLKQEAEDEDDSWATENGSEPSPEEEDEEDDVGDEERDRSSDSDG
EPWGVLDNLDGSRKGLTGRAQ
Download sequence
Identical sequences H2SI77
ENSTRUP00000012109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]