SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012825 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012825
Domain Number 1 Region: 284-381
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 204-297
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000012
Family I set domains 0.043
Further Details:      
 
Domain Number 3 Region: 27-80
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000291
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 4 Region: 448-733
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00000000000000327
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.035
Further Details:      
 
Domain Number 5 Region: 124-196
Classification Level Classification E-value
Superfamily EF-hand 0.00000000216
Family Calmodulin-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012825   Gene: ENSTRUG00000005344   Transcript: ENSTRUT00000012886
Sequence length 797
Comment pep:known_by_projection scaffold:FUGU4:scaffold_70:106310:172545:-1 gene:ENSTRUG00000005344 transcript:ENSTRUT00000012886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLMGHSRYPGPCQHKYCGLGQHCVVNHETGQGVCTCLDHCKPHYKPVCGSDGKLYQNHCE
LHRASCLKGFHITIVHSEECFYKDDNCRLTDYRQLKTKILDLYDKRYTGSNARGAHKDNM
AARKQLVDDMFKRFDADNSGRVDDNELSQHVIKQEGLFKDVSECTLFDLLKYNDVNDDEH
LTKEEFYTAFDVYLLTLPDDQKVSITTVTVGQSAVLTCAITGHSRPPILWKKNNNYLNSL
NLEDINDYGDDGSLYITKVTTTHMGNYTCHADGYEQLFQTHTLQVNVSVPPVIQVYPESQ
AREPGVTASLRCHAEGIPSPKLTWLKNGMDITPKLSKQLTLQANGSEVHISNVHFEDTGA
YTCIARNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPVAC
EIQRHIKPSEKLLALQEEVCPTSPGEEVQRCVWSSAVNVKDKFIYVTQPTLDRVLIVDIT
SQKAVQTVSTDPYPVKLHYDRSHDQVWLLSWGDMEKNFPILQVINQASGRVSHHTVHTQP
VGRRFDRVDDFFIPASSLIINHIRFGLIFHQNEPIFHKIDLETTSYVKNISLQEYNCIPK
SVAYTHLGGYYFVNCKPDSTGATQPQLILNSVTDTVIGQNGDVTGTPYMSPDGHYLVTVD
DRDGLMRIQIISERGEILAPFDIHTNLHLSDLAFQRSFTELHQYNIFGSSGRQTDVLFVE
LSSGKVKMIKSLKEATKSSEWPWSNRNRVMVSSGLFGQYLATPSRESLFILDGRLNKLNC
EITDVLKGNVVVWVGES
Download sequence
Identical sequences H2SK92
ENSTRUP00000012825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]