SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012893 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012893
Domain Number 1 Region: 430-674
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-56
Family Nuclear receptor ligand-binding domain 0.0000000342
Further Details:      
 
Domain Number 2 Region: 291-367
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.89e-23
Family Nuclear receptor 0.0000673
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012893   Gene: ENSTRUG00000005373   Transcript: ENSTRUT00000012954
Sequence length 677
Comment pep:known_by_projection scaffold:FUGU4:scaffold_5:173939:180524:-1 gene:ENSTRUG00000005373 transcript:ENSTRUT00000012954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLSCLSDFEKPSNSFEMSDRLDLADSCAFPSTAELCKAVSASLGLDTASSPVSNMNQG
FSGIGYSVYGSSAESGSELESTRDVNSEGAIPPGATDRCEEDFGEAHQYTVSCVELLGSG
EVDIAQSVTRAPVISGFVRKDSNLFTNPTGEVPAPTLASELTPRQPYNSHASNPRIYREN
PAVWRAFSGEAEPERPGGYNMLCKYCNCGQASNGSGLECRCVWYSDGEQGGKNGTQAAVA
QEYGQVEMYQNAKSQGHGAYSIKTEQPAWVDWTDRRFRHEDLLHGMYLSERRVCMVCGDD
ASGCHYGAVTCGSCKVFFKRAAAGKQNHLCASRNDCTIDKLRRKNCASCRLKRCFMSGMS
LKGRRLKGVAQAKNGEAEHPLTAWGPGEPGERSGNNRAVSEPGSAASRPHSASQTLAVSI
PPALSSCLSLLSVLQTIEPALVNAGYDHSQPDSPTSLLTSLNELGERQLVSVVRWAKAIP
GFRDLHVDDQMSVIQLSWMGVMVFALGWRSYTLTNCSLLYFAPDLVFNDKRMHLSSMYEH
CMRMKLLSQRFYMLKVTEEEFLCMKALVLFSIMPVEGPRSQRCFDELRTSYIKELDRLAS
HYGETTRRQRLFQLTQLLDYLQSVVRKLHQFTYDLFIQAQALQTQVNFPEMISEIVSVHV
PKILSGVVKPILFHGAD
Download sequence
Identical sequences H2SKG0
31033.ENSTRUP00000012893 ENSTRUP00000012893 ENSTRUP00000012893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]