SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000013081 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000013081
Domain Number 1 Region: 251-369
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.7e-57
Family Calsequestrin 0.00000196
Further Details:      
 
Domain Number 2 Region: 149-250
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.7e-24
Family Calsequestrin 0.0000504
Further Details:      
 
Domain Number 3 Region: 24-146
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.69e-19
Family Calsequestrin 0.0000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000013081   Gene: ENSTRUG00000005448   Transcript: ENSTRUT00000013142
Sequence length 416
Comment pep:known_by_projection scaffold:FUGU4:scaffold_305:277544:289727:1 gene:ENSTRUG00000005448 transcript:ENSTRUT00000013142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVILLRVFLSLGTLSWGEKGLEIPEYDGKDRVHDLSAKNYKSIMKKYDVMVIYYHKNV
DGNRSAMKQLQIEELALELAAQVLEDLDDEDIGFGLVDEKKDSAVAKKLGLDEVESIYIF
ADNEIIEYDGELAADTLVEFLYDVIEEPVEIIDNERELKGFHNMDDVIKLVGYFKSEKSP
HFIEYDDAAEEFHPFIKFFATFDPKIAKKLKLKMNEVDFYEPFMEEPVTIPGKPYIESEL
VEYIEQHDRPTLRKLHPHSMYEIWEDDIDGEHIVAFAEEDDPDGYEFLEILKEVAQENTN
NPNLSIIWIDPDEFPLLVPYWEKTFRIDLSSPQIGVVDVEDADSVWMEMDDDEDMPTADE
LEQWIEDVLSGKIDPDDDDEEDGDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
Download sequence
Identical sequences H2SKZ6
ENSTRUP00000013081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]