SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000013082 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000013082
Domain Number 1 Region: 252-370
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.28e-57
Family Calsequestrin 0.00000181
Further Details:      
 
Domain Number 2 Region: 150-251
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.82e-24
Family Calsequestrin 0.0000504
Further Details:      
 
Domain Number 3 Region: 25-147
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.36e-19
Family Calsequestrin 0.0000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000013082   Gene: ENSTRUG00000005448   Transcript: ENSTRUT00000013143
Sequence length 464
Comment pep:known_by_projection scaffold:FUGU4:scaffold_305:278466:289871:1 gene:ENSTRUG00000005448 transcript:ENSTRUT00000013143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKWGWVFLGVFLSLGTLSWGEKGLEIPEYDGKDRVHDLSAKNYKSIMKKYDVMVIYYHKN
VDGNRSAMKQLQIEELALELAAQVLEDLDDEDIGFGLVDEKKDSAVAKKLGLDEVESIYI
FADNEIIEYDGELAADTLVEFLYDVIEEPVEIIDNERELKGFHNMDDVIKLVGYFKSEKS
PHFIEYDDAAEEFHPFIKFFATFDPKIAKKLKLKMNEVDFYEPFMEEPVTIPGKPYIESE
LVEYIEQHDRPTLRKLHPHSMYEIWEDDIDGEHIVAFAEEDDPDGYEFLEILKEVAQENT
NNPNLSIIWIDPDEFPLLVPYWEKTFRIDLSSPQIGVVDVEDADSVWMEMDDDEDMPTAD
ELEQWIEDVLSGKIDPDDDDEEDGDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DDDDDDDDDDDDDDDEDDDDDDEDDDDDEDDDDDDDDDNDEDDE
Download sequence
Identical sequences H2SKZ7
31033.ENSTRUP00000013082 XP_003977884.1.43653 ENSTRUP00000013082 ENSTRUP00000013082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]