SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000013444 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000013444
Domain Number 1 Region: 37-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-44
Family SPRY domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000013444   Gene: ENSTRUG00000005581   Transcript: ENSTRUT00000013506
Sequence length 610
Comment pep:known_by_projection scaffold:FUGU4:scaffold_298:167752:178109:1 gene:ENSTRUG00000005581 transcript:ENSTRUT00000013506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELGTGSLSLGDTTFKYQERELNERLRRLYPAVNEEESPLPRSWSPKDKYSYIGLSQNN
LRVHYKGHGKNHKDAASVRATYPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRL
PGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNGISLGVA
FTDLPPNLYPTVGLQTPGEIVDANFGQQPFVFDIEDYMSEWRAKIHGMIARFPIGERLGE
WQTVLQNMVSSYLVHHGYCATATAFARATETKIQEDQTSIKNRQRIQKLVLAGRVGEAIQ
VTQQLYPGLLEHNPNLLFVLKCRQFVEMVNGTDGEVCGLNLHSPKSQDCYPAILSPHHGA
TNTHSHSAGSESPTCSNGISPTNKSKSHSGTSVKYPRMSSVSSSTTSSPSSINSSESNSS
DSMESQPHSANRSQENRHSDSEMEMEAEHYTNGVVEGSTQIMNGSYNHEEMLQQEDLSME
HQSCSKNGQLCGGTRAATERMIQFGRELQGLSEQLCREYGKNTAHKKMLQDAFSLLAYSD
PWNCPVGQQLDPTQRESLCSTLNSAILESQNLPKQPPLMLALGQATECVQLMARVRSGSC
SFARVDNFLH
Download sequence
Identical sequences H2SM08
31033.ENSTRUP00000013444 ENSTRUP00000013444 ENSTRUP00000013444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]