SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014028 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014028
Domain Number 1 Region: 4610-4765
Classification Level Classification E-value
Superfamily SET domain 4.84e-43
Family Histone lysine methyltransferases 0.0089
Further Details:      
 
Domain Number 2 Region: 1010-1071
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000012
Family PHD domain 0.0047
Further Details:      
 
Domain Number 3 Region: 392-453
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000131
Family PHD domain 0.0024
Further Details:      
 
Domain Number 4 Region: 1084-1155
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000266
Family PHD domain 0.028
Further Details:      
 
Domain Number 5 Region: 961-1019
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000019
Family PHD domain 0.017
Further Details:      
 
Domain Number 6 Region: 342-395
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000399
Family PHD domain 0.013
Further Details:      
 
Domain Number 7 Region: 1678-1725
Classification Level Classification E-value
Superfamily HMG-box 0.0000265
Family HMG-box 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000014028
Domain Number - Region: 470-526
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000419
Family PHD domain 0.025
Further Details:      
 
Domain Number - Region: 283-336
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0377
Family PHD domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014028   Gene: ENSTRUG00000005765   Transcript: ENSTRUT00000014093
Sequence length 4765
Comment pep:known_by_projection scaffold:FUGU4:scaffold_285:149176:185130:-1 gene:ENSTRUG00000005765 transcript:ENSTRUT00000014093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEEKTVEPSDQGTSPPSSSVGAASTGSPAHPDKRPRGRPRKDACALLPQAPPSSMSKN
RKKGRTRGRAVVDEEDSMDGTEITESIGPQDTAAETPIQHVEAVEVVTTEVTEEDGPSSP
LPQSPPAGTSVGPAVPESREVKSRERLCAFCYCGSRSLLGQGDLQVFGIAPQLEALFSNK
DGGGSASDSGDGDKTTQPKMPGETTSGQRAKTNGSESCEEEPERTSGVLDELSHVGLPPH
LNVQSLFESAGQCWAHQSCALWSEGVRQGEGQSLLNVDRAIYSGSTKHCAYCKRLGASIK
CCAEGCAQLYHYPCAGAAGTFQDIRSFSLLCPEHTEQAIHKFVDDVHCTLCDSPGDLLDQ
LFCTSCGQHYHGTCLDMAVTPLRRAGWQCPECKICQTCMNPGEDTKMLVCDMCDKGYHTF
CLQPAIDSLPTNGWRCKNCRVCVQCGTRSSKQWHHTSLLCEICVQNQDPALCCPVCACTL
DPEHQKDLLLCHICKRWLHLECERQHSGRAEIHPREDYVCSSCRCPAAEQTEDVDAGPEL
TSQPASMHTDPETDLQPAKKHTDLEFGTQPPPQMHNDPKPQLLAVPTHSDPEPAQAAVQE
EELDTSASKPGCETLHPVNVKLEPKLSERDSNSFVGVEISTERGGRKRGCLQNVVASPKI
QIIVKFVFVRHHPHSLLEEPESFPVGPSLESPPTQDATSVKPAKTEVCSAEGLVIFSTKK
EFLKEKVEGAFYRNLSESGKALGSGSCKSEEKSTVQDIKPSVSLSNLSSEERPLKTSVER
LAEMISFPCHSSPLGRGATPRELLQAQSRPLLGDHSSAVPTTTLIPLPPKIGMGKPAITK
RKFSPGRPRVKQGAWSPHSSVSSPLSWSPDQPEGWDVQKTRQSSGSPGWSIRVGRGSGFP
GRRRPRGAGLSGRAGRGRARGKNGANASINPGVITIETPYPVKEEEENAMHNTVVIFSSN
DNFTLKQDMCVVCGSFGLGAEGRLLACAQCGQCYHPYCVGIKINKVVLSKGWRCLECTVC
EACGQATDPGRLLLCDDCDISYHTYCLDPPLQNVPKDSWKCKWCVTCTQCGATTPGLRCE
WQKNYTQCAPCASLVTCPICLVDYSEGTTILQCRQCDRWFHASCQSLHSEEDVEKAAENG
FNCTMCRTFKSTKVVAKARDVIDPQVMTQIFTKAKEMDLSRTYTQDGVCLTESGLCQLQS
LSATASRRRKPKPKLKLKIINQNSVAVLQAPLDPPSEHSRDEDMEDNREAELLECEVKSD
SSLEREPVEDDSKGADNGKKRKRKPYRPGIGGFMVRQRNRPGQGPSKAKRSLCRKDSSGS
MSEIPAGKDEGWSETLPDTPVDELPPGPEVPEKIKKRYRKKKTKLEEAFPTYLQEAFFGK
DLLDKSKQSRHQGVETGLLEDGQSQVERKYSASTFLDPSSDPLLSASTAALPTRPAAGQP
SEEPLVDLSDVLNTDPDILGMLGKPSADSAGLDIGPLTDSSSVVPPSQMGRRTPRSLPEE
PLDGILSPELDKMVTDESILSKLHKIPELGGKDVEDLFTAVLSPSTNHPPPPPQVPHPQG
PGPFPRNPMFPRMPMINGLMGPNQQRFPTNQGAGPCMPDNFPPLNRMPFTDNPRDKKFNQ
MPKEAVGPWPPSAHGPGPAPPGPLPEGETEAMSNAQRSTLKWEKEETLGELATVAPVLYT
NVNFPNLKDEYPDWSTRVKQIAKLWRKASSQDRAPYVQKARDNRAALRINKVQMSNETMK
RHHLQQQQQQPPEVFDPNIPLDTELLFKDPLKPKESEHEQEWKFRQQMRQKSKQLAKIEA
TQKLEQVKNEQLQQQQQQQGNSQSEGNGSNSGSQSPASQPSNGSMSPMQQHNSKEGFVRP
QLPGTPTQCPPEDVFLRPPPPPPSGPSSQPQSPQVFSPGSSGSRPSSPWDPYAKMVGTPR
PPNIGPNTCRRIPIESGKSPSAVMEHQDRGRPSPAHESFGSPTSMSSDPYAKPPDTPRPT
SEIDPFLKPIGPPRVSQAAQGRPPMGSPGRDPYSRPMIRNEAYQRMAQNRMILSDPYSRP
LLAPIPGSNEAGSVPLFKTPMPPPQTQDAFSRPGAHSAERFSQNHQNDPYAHSPHTPRPS
GNDNFTSPPRIGQHHPQVHPFAQPGPVNQMSRNPYAHAPSTPRPDHFTSFARAPGTPRPH
DSYGQPSNPSPSSDPYSQAPSTPRPTGMNQFSHQAHPGQRMSPSHSMDPYAQPPGTPRPS
VGERYSKSPGSQRGPLEPFGSTSGPSRSDGSDMFSQPGAQRPMPNDPYAQPPGTPRPGQG
PRLGPIGSQDPFSSPQEDGFTQSPSRRPGQTPGHDPFEQTSMTHCPQSTEKVEMKDQSGV
RSSGTVPQATGQLSTSQMPGAPSEAQSVSLAESEERLRQRQRIRELILKQQQQRSAIRQE
RGPQDLAGNLTGARAWPQEANVQQGEMFNRPPPPYPGQGPMRGPMRFPGPFPGDQRFPFP
NDGQVPRGLRVAFPPLGPHGPQEFFQRGPHPVPDVPPQMRRPMPAEMAKGLGGNSMGIPQ
HFSAHGVPVQQHNIMGQTFIELRHRAAENRPRLPFPPAAMPGNNIDLNMHVQRPPGFPGV
PDSRFPLNQGLRMVDPMVSQAGHVQRSGSMDSLHQHAQMAGNGDNKQSPLMRSMSQPASN
ETQNMPASVVLAVPPVGQMENVSVASGEAVEEKLDAEESAVKDLEDVEVKDLVDADLENL
NLDPDDGKDLDLETNDLHLDDFLTSGKFDIIAYTDPDLDDIKKDMFNEELDLSDPIDDNA
DTADIKTQSAGAEASTSGSLLVQPEAQPPAQVKLEAPGAQDSGSVAPGPEIKTEVKDCQK
AAAVGEHHAAGNAVTSNQQGALSSATPVLSSLLIKQQPEEQSLNPILESVSQGANLLTQQ
NQAVDTQCNPGMVMAQTLADAASAGESSMAAFGADHQAALAPGVDPSSLTPAQQTALNQA
MGQNSQHRPLLLEEQPLLLQDLLDQERQEQQQQRQMQAMIRQRSSDSFFPNIDFDAITDP
IMKAKMVALKGINKVMVQNNMGMAPLVMNRIPPGPAPPCPESTPLPPQVVGQDGKLTQVA
RPNPPNFGPGFGNNAQRAQYEEWLQETQQLLQMQQKFLEEKIGAHRKSKKALSAKQRTAK
KAGREFPEEDAEQLKHVTEQQGVVQKQLEQIRKQQKEHAELIEEYRVKQQQNNMTPIMSG
MHPVPGPAGMVPGGPPMVPGRPQLVQPPVNTMMQMPLHPGQPNAPCMPNPPPGWHPGAPV
PMGGPGNMPPHPQMPVDPQAPQAPPVGMKHMQTGPVKFDDNNPFSEGFQERERRERLREQ
QERQRVQLMQEIERQRALKHRMEMEQQGMMGADGGMAPLSQMPFFNSDLPQDFMQPQRPA
MQQQQHPGPMFPQQHGMQPGIGSPPGTCMQGERRAVVGNGLMPRDMGHGFGPDAPALQAA
NFPHAQPRSRQVSGPGMLLQMPGEGPPFGGDTSTPLPSNFPGSGQSLIQLYSNIIPDEKG
KNKRNRKKKKDDDADSIKTPSTPHSDLTAPLTPCVSDTSSTPTRNAHLFSEQDLSRSPLL
GSSTPSHSELERQLSGGQSGSSGDAARAQDHDSILNNIKLEQMDVSECHGPREGHLASDM
SSVKEEGNKGSGSPFSAGQSPNKGEAGNELLKHLLKNKSTPPPGISQQRSEESQRSEEED
PADCKSLLRQSSMDSNGATRQSRVQACSDGTPDFPGPLLSDQEKKKGRNKRSQKGGEKPA
SRYKKRKKDGEEKQLMHPGSDSVMTQIKQQSNLSNPPTPPASLPPPPPVNQQKMINGFAT
TEELANKAAAMVSKGLVPKPLHVPFRTEEDLLARAIAQGPKTVDVPASLPTPPHNNQEEL
SRQEPCKDRDTPDSFVPSSSPESVFGMEISRYPDLSLVKEEMPSPCQSPVLPMLPAADGK
GSAIKLQDIKTEPSSMFLGHPFGSMSTESRQGLVSVAITLRPAAAENITGVVAAISDLLS
VKIPSSYEVSSTPDRGPRVGPQGMEAHAPMLYHGQRDNGGLHIRPGHMMRPSGGHELMQQ
QAHNFPFHLNRAGLGRGRDERIPASPGCKPHWCCHCKVVVLGNGVQKSTKDLPVHIKESG
VRLKSEENLVFCSHSCFLLYCSSSALQSRASVERKELSSPLPVSEHTESLSKTLHQYSNN
MSSLDVHCLAQLQPKQSPPSTPPLSFPTAGDASRMETKSDAIKVTVKLKARPRSQDGWHQ
GKRQKGLKWRKWTIQVVVPRGNSQLPDEDKIDELLSKLGASLRPPALLRDHRRCCFCHQF
GDGLTDGPARLLNLDLDVWVHLNCALWSTEVYETQAGALINVDLALRRGQSVRCAYCQHT
GATSGCHRLRCTNVYHFTCALQAQCTFFKDKTMLCHAHRPRGSAGHALEHELRCFAVFRR
VYVQRDEVRQLATAVGQPELGYTFRVGSLVSHSMGQLTPLQMAAFHSSTAIFPVGYEACR
IYWSMRHGNRRCRYVCSVEDREGQPEFTIRVVEQGYKDLFLTDTSAKGVWDKVLGPVADK
RTESGTLKLFPVYLKGEDLFGLTVPAVAKITESLPGVEACERYSFRYGRNPLVELPLMLN
PAGSARAQPKTGSPYTSLVIRPQQQTVPSSSARSNQNVAQGEGNKPPVVHPRSSQYRWMK
SEWRANVYLARSRVQGLGLFAARDMEKQTMVIEYNGTILRKEVAIMKEKIYRSQNRAVFM
FRIDSEHVVDATRTGGLARYINHSCAPNCVAEVVTFERGHKIIISCVRRIAKGEELCLDY
QLDSAEGQHKTACHCGAPECRKWIN
Download sequence
Identical sequences H2SNP1
ENSTRUP00000014028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]