SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014050 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014050
Domain Number 1 Region: 285-518
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-69
Family Nuclear receptor ligand-binding domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 69-158
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.99e-30
Family Nuclear receptor 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014050   Gene: ENSTRUG00000005774   Transcript: ENSTRUT00000014115
Sequence length 521
Comment pep:known_by_projection scaffold:FUGU4:scaffold_66:274114:280056:1 gene:ENSTRUG00000005774 transcript:ENSTRUT00000014115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPSSSSSSSRTHGRLCTDAACSDGGGEPGGHAMCLGGAGAGGGRAEGSGRGKRPCGFAG
TFTKSGGMVLLCKVCGDIASGFHYGVHACEGCKGFFRRSIQQNINYKMCVKNENCLIMRM
NRNRCQHCRFKKCLSVGMSRDAVRFGRIPKREKQRLLEEMQSYMNSLNESANMEMDSSPV
RETPPNPEDCSSKEAIGAISRAYRNIFSTSSDGGSQERPAKRANISTNNNNTSAFSQDAN
FHHRNSTQSYHSCPITPAAHCPAFRNVDNSGYAFSISTNNNYEQPHSTTNPRGTSGDYNS
FHSAENTPNQPSCPWKLAPGSKVLACPLNAWPVSGPERSSQEIWESFSQCFTPAVKEVVE
FAKGIPGFQELSQHDQVMLLKSGTFQVLMVRFCTLFNAEKHTVTFLNGQTYPLSSLRALG
MGSLLDAMFEFSEKLGSLGLEPDEMALFMAVVLVSADRTGISDMRAVEQLQESLIRALRS
LITRHRPDDTALFPKLLLRLPDLRTLNNMHSDKLLAFRINP
Download sequence
Identical sequences H2SNR3
ENSTRUP00000014050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]