SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014051 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014051
Domain Number 1 Region: 359-561
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-55
Family Nuclear receptor ligand-binding domain 0.0000524
Further Details:      
 
Domain Number 2 Region: 159-224
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000428
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014051   Gene: ENSTRUG00000005774   Transcript: ENSTRUT00000014116
Sequence length 561
Comment pep:known_by_projection scaffold:FUGU4:scaffold_66:275960:279951:1 gene:ENSTRUG00000005774 transcript:ENSTRUT00000014116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSPGSPSSGYQTQSPSSKSQPSSPKEVTFTEIGVLKHRAGGGTTPSSKLVFQFPEVYSGP
PAAAATPHHTFGHPIAGKRPCGFAGTFTSFCRLLPFFLFYSFISRVRWDGPALQSLWRHC
IWFPLWSACVHLPQETNDARSSFRHMHAVSLCPCLFFFQGFFRRSIQQNINYKMCVKNEN
CLIMRMNRNRCQHCRFKKCLSVGMSRDAVRFGRIPKREKQRLLEEMQSYMNSLNESANME
MDSSPVRETPPNPEDCSSKEAIGAISRAYRNIFSTSSDGGSQERPAKRANISTNNNNTSA
FSQDANFHHRNSTQSYHSCPITPAAHCPVTSSDNKQAFRNVDNSGYAFSISTNNNYEQPH
STTNPRGTSGDYNSFHSAENTPNQPSCPWKLAPGSKVLACPLNAWPVSGPERSSQEIWES
FSQCFTPAVKEVVEFAKGIPGFQELSQHDQVMLLKSGTFQVLMVRFCTLFNAEKHTVTFL
NGQTYPLSSLRALGMGSLLDAMFEFSEKLGSLGLEPDEMALFMAVVLVSADRTGISDMRA
VEQLQESLIRALRSLITRHRP
Download sequence
Identical sequences H2SNR4
31033.ENSTRUP00000014051 ENSTRUP00000014051 ENSTRUP00000014051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]