SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014165 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014165
Domain Number 1 Region: 55-164
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.06e-34
Family PDI-like 0.0034
Further Details:      
 
Domain Number 2 Region: 168-281
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.68e-34
Family PDI-like 0.001
Further Details:      
 
Domain Number 3 Region: 486-633
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.2e-33
Family PDI-like 0.00099
Further Details:      
 
Domain Number 4 Region: 283-391
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.74e-18
Family PDI-like 0.026
Further Details:      
 
Domain Number 5 Region: 388-520
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000388
Family PDI-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014165   Gene: ENSTRUG00000005810   Transcript: ENSTRUT00000014230
Sequence length 640
Comment pep:known_by_projection scaffold:FUGU4:scaffold_152:238504:241966:1 gene:ENSTRUG00000005810 transcript:ENSTRUT00000014230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMKKLALLLIVLLGVAHLIPAGKCEDGKDDAENENTEEESDDEEEEEDDDDTEVKEENGV
LVLTDGNYDTFMEGKDTVLVEFYAPWCGHCKQFAPEYEKIAESLKENDPPIPVAKVDAVL
SSGLGSRFDVSGYPTIKIIKNGEPVDYDGERTEKAIVERVKEVAQPDWKPPPEATLVLTK
DNFDDTVNGADIILVEFYAPWCGHCKRLAPEYEKAASLLSQRSPPIPLAKVDATVEAELA
SRFGVSGYPTLKIFRKGKVFDYNGPREKYGIVDHMVEQSGPPSKQVQAAKQVQELIKDGD
DAVIVGIFSSEQDAAFEIYIEACNALREDFTFRHTFNSEVSNLLKASPGQVMIVQPEKFR
SKYEPASHTLAIKDDTLVSEVQEFFKKNVIPLVGHRKPSNDAKRYTKRPLVVVYYGVDFS
FDYRKATQFWRSKVLEVAKDFPEYVFAIADEEDYGEELKSLGLSESGEEVNVGILEDGGK
KFAMEPEELDADVLRDFVMAFKKGKLKPIIKSQPVPKNNKGPVKVVVGKTFDEIVMDTQK
DVLIEFYAPWCGHCKKLEPDYLALAKKYKGEKNLVIAKMDATANDVPNDGYKVEGFPTIY
FATSNSKQTPIKFEGGDRTLEGFSSFLEKHATKLSQKDEL
Download sequence
Identical sequences H2SP28
ENSTRUP00000014165 31033.ENSTRUP00000014165 ENSTRUP00000014165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]