SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014353 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014353
Domain Number 1 Region: 235-496
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.93e-84
Family Eukaryotic proteases 0.0000000742
Further Details:      
 
Domain Number 2 Region: 156-239
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-23
Family Kringle modules 0.00066
Further Details:      
 
Domain Number 3 Region: 43-96
Classification Level Classification E-value
Superfamily GLA-domain 7.06e-20
Family GLA-domain 0.00042
Further Details:      
 
Domain Number 4 Region: 96-145
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000725
Family Kringle modules 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014353   Gene: ENSTRUG00000005893   Transcript: ENSTRUT00000014419
Sequence length 496
Comment pep:known scaffold:FUGU4:scaffold_57:452165:458409:-1 gene:ENSTRUG00000005893 transcript:ENSTRUT00000014419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLSLLACVIVCRLCWTRSFLDCSIWIFLSSRSASQVLVRSRRANQMFEEIKAGNLEREC
MEEKCNQEEAREVFEQPDTTEAFWKKYLGDGDCESLNICVFSGFCISGRGLNYAGNVNIS
KSGIQCQHWKHSFPHPIMSICEHYKPAEPSVPKYCSKSSCISNYGVDYVGDLDVSAKGHA
CLMWSSPEAVTLSQNKEFDPDINLLCNKCRNPDKDPEGPWCYVNASGKVIVDYCDLPSYR
EKRIVGGDEAEVASAPWQVMLYKRSPQELLCGASLISNEWVLTAAHCILYPPWNKNFSAS
DILVRLGKHNRAKFEQGIEKIMVVDLIIVHPKYNWKENLNRDIALLHLRRPIPFSNVIHP
ICLPNKKVARMLMTTGFKGRVTGWGNLKESFDPAARNLPTKLQQIHLPIVEEDVCRSSTS
IRITDNMFCAGYKPEDNKRGDACEGDSGGPFVMKHPEENRWYQMGIVSWGEGCDRDGKYG
FYTHVFRMTKWMRKVI
Download sequence
Identical sequences H2SPL6
ENSTRUP00000014353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]