SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014548 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014548
Domain Number 1 Region: 167-408
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-70
Family Nuclear receptor ligand-binding domain 0.000000002
Further Details:      
 
Domain Number 2 Region: 54-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-27
Family Nuclear receptor 0.00000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014548   Gene: ENSTRUG00000005981   Transcript: ENSTRUT00000014616
Sequence length 427
Comment pep:known_by_projection scaffold:FUGU4:scaffold_253:33225:42296:-1 gene:ENSTRUG00000005981 transcript:ENSTRUT00000014616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEKTAAHGEPSSHPPRWPNVPKRRCKNSHCSEKSMSAFSVSVPGYIPSYLEKDEPCVVCG
DKATGYHYRCITCEGCKGFFRRTIQKNLHPAYSCKYEGCCIIDKITRNQCQLCRFKKCTS
VGMAMDLVLDDSKRVAKRRLIEENRQRRKKEEMVRMLQARPEPDTAEWELIRMVTEAHRH
TNAEGSTWKQKRKFLSDDIGQGPVVPSSDGDKVDLEAFSEFTKIMTPAITRVVDFAKKLP
MFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLSGKIAVKREQLKNGGLGVVSD
AIFDLGKSLAQFNLDDTEVALMQAVLLMSSDRSGLTSVEKIEQCQEAYLLAFEHYINYRK
HQIPHFWPKLLMKVTDLRMIGACHASRFLHMKVECPNELFPPLFLEVFEDQETPTTPATS
SRTSTLR
Download sequence
Identical sequences H2SQ61
ENSTRUP00000014548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]