SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014657 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014657
Domain Number 1 Region: 236-333
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.27e-31
Family Thioltransferase 0.0000342
Further Details:      
 
Domain Number 2 Region: 133-230
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.26e-29
Family Thioltransferase 0.0000812
Further Details:      
 
Domain Number 3 Region: 13-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.3e-24
Family Thioltransferase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014657   Gene: ENSTRUG00000006029   Transcript: ENSTRUT00000014725
Sequence length 336
Comment pep:known_by_projection scaffold:FUGU4:scaffold_170:263461:264471:-1 gene:ENSTRUG00000006029 transcript:ENSTRUT00000014725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSAESRRSNLNMANFVEATSQHQFDDFLSKAGRNLTVVHFQATWAHQCGQMNEVMAELAK
EHTHATFVKLEAEAVPEVSEKHEITSVPTFLFFRGKEPVDRLDGANAPELTKKVKRLAAS
GSPSGGAESPVVDLDQRLKKLINAAPCMLFMKGSSQEPRCGFSRQIIAILSQHNIQFSSF
DILSDEEVRQGLKTFSNWPTYPQLYVNGELVGGLDIVKELAESGELANTCPKAQSLEHRL
KTLINQSPVMLFMKGNKEAAKCGFSRQTLSILSNTGVAYDTFDILQDEEVRQGLKTFSNW
PTYPQLYVKGELVGGLDIIKELEENGELVSTLKAES
Download sequence
Identical sequences H2SQH0
ENSTRUP00000014657 31033.ENSTRUP00000014657 ENSTRUP00000014657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]