SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000015031 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000015031
Domain Number 1 Region: 150-258
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.03e-34
Family PDI-like 0.0065
Further Details:      
 
Domain Number 2 Region: 288-391
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.32e-31
Family PDI-like 0.0058
Further Details:      
 
Domain Number 3 Region: 21-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.12e-28
Family PDI-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000015031   Gene: ENSTRUG00000006178   Transcript: ENSTRUT00000015100
Sequence length 398
Comment pep:known_by_projection scaffold:FUGU4:scaffold_162:672152:677652:1 gene:ENSTRUG00000006178 transcript:ENSTRUT00000015100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTFIYSSLLFVSVFCTEDADNEHVKHTYTVEMFNDAVPTAPHFVMFYAPWCGHCQRLQP
TWNELADKYNSMDDPPVYVVKLDCVQDTKFCSNVHGIRGYPTLKLFKPNEEAVKHQGPRD
LESLETWMLKTLQEGPLEPESELEPPKVPEPKQGMYELSALNFKAHIAKGSHFIKFFAPW
CGHCKAMAPTWEQLATTLEHSDDIKIGKVDCTQHYEVCSENGVRGYPTLLFFHNGQKTDQ
YKGKRDLDSFKDFVDKQLKANIANEQVQEQEKEAENQIPTAEPATEESSLLILTNDNFEE
TVAKGLTFVKFYAPWCGHCKNLAPAWEDLSKKDFPGLADVKIAKVDCDSERTLCNKHSIN
GYPTLIMFKAGKQSQEHNGGRDLESLHKFVMTYARDEL
Download sequence
Identical sequences H2SRJ4
ENSTRUP00000015031 ENSTRUP00000015031 31033.ENSTRUP00000015031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]