SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017123 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017123
Domain Number 1 Region: 105-189
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000367
Family Caspase recruitment domain, CARD 0.025
Further Details:      
 
Domain Number 2 Region: 4-85
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000225
Family Pyrin domain, PYD 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017123   Gene: ENSTRUG00000006977   Transcript: ENSTRUT00000017196
Sequence length 192
Comment pep:known_by_projection scaffold:FUGU4:scaffold_196:210437:211780:-1 gene:ENSTRUG00000006977 transcript:ENSTRUT00000017196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKTIKMAIKDSLENLGKQNLNKFRSALLDRREGPRVPVSRVEDEDFLGITDVLVSTFGEF
SAAEVTLDLLKQIKCNGEAEALGKTFQSGRPSASVKVDAIKKSSPPDEHFVDKYRCALIN
RVSNIAPILDELLNKKVIDQETYERIRGLPTCQEKIRELYCSGLKGGKACKDAFLKSLEK
NERFLIDHLRTN
Download sequence
Identical sequences H2SXI5
ENSTRUP00000017123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]