SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017696 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017696
Domain Number 1 Region: 60-158
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-30
Family Ras-binding domain, RBD 0.00013
Further Details:      
 
Domain Number 2 Region: 386-495
Classification Level Classification E-value
Superfamily SH2 domain 7.54e-29
Family SH2 domain 0.000011
Further Details:      
 
Domain Number 3 Region: 192-303
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-16
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017696   Gene: ENSTRUG00000007194   Transcript: ENSTRUT00000017770
Sequence length 499
Comment pep:known_by_projection scaffold:FUGU4:scaffold_130:282913:290817:-1 gene:ENSTRUG00000007194 transcript:ENSTRUT00000017770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPSSPPPPPHPPPVLVRRSQPIFITSHRARSESCSSVPSIPNPFPELCSPSKSPVLISSL
PPQSSAKHLIKVYGEDSHSRPVWVSSGATAREVCHLLVQTAHCSDQENWALLEVHPTLGL
ERCLEDHEVVLEVQASWSLKSDTRFVFCKNYAKYEFFRKPMLFFPECMISDSADVTKAKT
SSALIQNLLKSGACPEIQGFLHLKEPNRKSWKKVYFFLRRSGLYSSTKGSSKEPRHLQYV
ADLNDLNVYSVVNSRKLYGAPNDFTFCIKSSRSPVRSQDLKMMCAENEQTRRCWTSAFRL
FKYGKQLQCNYQLSKSTPLVPLGLEGRRLTESTSEASLVAMDFSGKAGGRVIQNPAEAQS
AEQEEGQAWRRREALRCSLPNLNSGPKPSLAVHVSQPWFHGGVSRKEAQRLIEKQGLVDG
MFLIRESQQHGQCFVLSLSHQLKIKHYLVIPCEDGGRKYFTIDDGLTLFIDLLQLVEFHQ
INKGILPVCLKHPCVCVAL
Download sequence
Identical sequences H2SZ58
ENSTRUP00000017696 ENSTRUP00000017696 31033.ENSTRUP00000017696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]