SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017773 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017773
Domain Number 1 Region: 380-547
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-60
Family SPRY domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 12-80
Classification Level Classification E-value
Superfamily RING/U-box 3.76e-17
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 135-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.14e-16
Family B-box zinc-binding domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017773   Gene: ENSTRUG00000007217   Transcript: ENSTRUT00000017847
Sequence length 554
Comment pep:novel scaffold:FUGU4:scaffold_186:454879:457586:-1 gene:ENSTRUG00000007217 transcript:ENSTRUT00000017847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMSSAVLLSEVQFQCFICQNVFCEPVSIPCGHSFCFSCITSHWENAGVSCPKCQTVFDGR
PELCENSFAKEMSEKIRLRRQNASLSLTKSFVYCDVCTGKRSKAVKSCLVCLASYCESHL
EPHLRVATLKIHKLTKPVAMLEKRMCKRHQRLLELFCRSDQKCVCLLCTESEHRGHHTVP
VERESQEKKIQMKRIQDDVQQMIQERMQKVREIKHCVELSKENSRRDTMESLEVFAALMR
SMERIETELVQMIQRKQAAAEQRAERLIAELELEITELERKRCEMEQLSDTEDHLHLLQD
QRFPALCSTSVTTSCSDLVVHADTSLGAVRRAVADLEHQLQASLQRFSFQGQLSRHIVCD
RSYIDKLIATSKPLMSPNFKQPADVHLDPRTANPWLVLSEDGKQVWDGNLKQILVDIPER
FNMAPCVLGTKGFTTGRHYWEVDVGEKTSWDLGVASQSVDRKGVVTLSPEDGYWTVCLRN
GSEYRACAGEAELLRLPRKPKIIGVFLDFEDGTVSFYDADAKSHMYSFTDYQFREAMFPF
FNPDSFKRLRVVFC
Download sequence
Identical sequences H2SZD5
ENSTRUP00000017773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]