SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017854 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017854
Domain Number 1 Region: 355-508
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-33
Family SPRY domain 0.0013
Further Details:      
 
Domain Number 2 Region: 5-60
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000193
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 136-171
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000121
Family B-box zinc-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017854   Gene: ENSTRUG00000007243   Transcript: ENSTRUT00000017928
Sequence length 508
Comment pep:novel scaffold:FUGU4:scaffold_296:209173:211955:-1 gene:ENSTRUG00000007243 transcript:ENSTRUT00000017928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMESKLEETLTCSVCQEIFEDPRQLPCGHSMCLGCLENLRDHCTDVPFRCPNCRKYFGP
YIGISKSFTLTTIVEDYQEIRRRKGGADRRVCCDCCPDQQNPAVKTCLKCEVSLCGEHVK
DHLERPAFADHPLAKPLREISKRKCPVHKEEVARHYCENSRRYVCHLCVQDSNQQNLTKG
VSALLKSKLSVRSQPWNLRTDETGFSGPRNVQVTKCSFTLSPEHYVMLESSLWNFLELVT
LEHLTHVDERLEMMKHQVRESNQSIKTLQEDMRREIRSRAEGETVSDPQTGPKERIQQHK
RYCKKSVTEGGITAKVISTHSETFVPNSYLSFTEKLVDRPVNSHFPPVTKDKEVLMLDLD
TANDYVKISDDLRTAQKVRTRIRYPSRPNRFEEAPQVLSSHCFGTGAHTWEVEVEGYWDV
AVSFRGIKHERNSRSAFGNNPHSWSLTHNGSGKLVAYHDGKKTVVPARLQSNRIAVMVDF
EKGNITFASVGSTATRLHEFKAKLTQPV
Download sequence
Identical sequences H2SZL6
ENSTRUP00000017854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]