SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017855 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017855
Domain Number 1 Region: 349-502
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-33
Family SPRY domain 0.0013
Further Details:      
 
Domain Number 2 Region: 3-58
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000144
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 132-167
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000119
Family B-box zinc-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017855   Gene: ENSTRUG00000007243   Transcript: ENSTRUT00000017929
Sequence length 502
Comment pep:novel scaffold:FUGU4:scaffold_296:209173:211949:-1 gene:ENSTRUG00000007243 transcript:ENSTRUT00000017929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESKLEETLTCSVCQEIFEDPRQLPCGHSMCLGCLENLRDHCTDVPFRCPNCRKYFGPYI
GISKSFTLTTIVEDYQEVHQGGADRRVCCDCCPDQQNPAVKTCLKCEVSLCGEHVKDHLE
RPAFADHPLAKPLREISKRKCPVHKEEVARHYCENSRRYVCHLCVQDSNQQNLTKGVSAL
LKSKLSVRSQPWNLRSYQEHLTHVDERLEMMKHQVRESNQSIKTLQEDMRRERETAKEKA
YPPESPANSITVLLLVLWLMVLVYGNRTQNRNVPFLSTGETVSDPQTGPKERIQQHKRYC
KKSVTEGGITAKVISTHSETFVPNSYLSFTEKLVDRPKMLYLSISTEVLMLDLDTANDYV
KISDDLRTAQKVRTRIRYPSRPNRFEEAPQVLSSHCFGTGAHTWEVEVEGYWDVAVSFRG
IKHERNSRSAFGNNPHSWSLTHNGSGKLVAYHDGKKTVVPARLQSNRIAVMVDFEKGNIT
FASVGSTATRLHEFKAKLTQPV
Download sequence
Identical sequences H2SZL7
ENSTRUP00000017855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]